KEGG   Eremothecium cymbalariae: Ecym_1276Help
Entry
Ecym_1276         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
erc  Eremothecium cymbalariae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ecym_1276
Enzymes [BR:erc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Ecym_1276
Glycosyltransferases [BR:erc01003]
 Polysaccharide
  Storage polysaccharide
   Ecym_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(562592..564697)
Genome map
AA seq 701 aa AA seqDB search
MTRDIQNHLLFETATEVANKVGGIYSVLKSKAPVTCGQYKEHYHCIGPLNPDSVQIEVEQ
IDWEHGDGVWSMEMLPVKRTLQHMRERGVNFVYGRWLIEGAPKVILFDLESVRHHLSEWK
SDLWTTAGIPSPEDDMETNNAILLGYTVAWFLGELAAQDQRHAIVAHFHEWLAGVALPLC
RRRRIDVVTIFTTHATLLGRHLCAGNADFYNNLDSFDVDSEAGRRGIYHCYCIERAAAHT
ADVFTTVSQITAYESEHLLKRKPDGILPNGLNVIKFQTVHEFQNLHALKKERIHDFVRGH
FHWNYDFDLDNTLYFFVAGRYEYRNKGADMFIEALARLNYRLKAAGSKMTVVAFIIMPAK
NRSYTVEALRGQAVVKSLENTVKDVTTLIGKRLFEHAVRYPRSGKSEIPNELGELLKPSD
MVLLKKRVFALRRPEGSLPPIVTHNMVDDAADPILNQIRRVQLFNHSSDRVKIIFHPEFL
NANNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDLI
ERDQAKDYGIYIVDRRFKSPNESVEQLVDYMDEFCKKTRRQRINQRNRTERLSDLLDWKR
MGLEYVKARQLALRRAYPEEFMALVGEDLDDQDMDSLAGGQKFKVARPLSVPGSPRDRSS
SMSAILMTPGDLGTLQDANNANDYFHLSMQDEDENDEEDQN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgacaagagatatacaaaaccatcttttgttcgagacggcaacagaggtggcaaataag
gttgggggtatttactctgttttgaagtcgaaggcgcctgttacatgcggacagtataag
gagcactatcattgtattgggcctttgaacccggactcggtgcagatagaggtggagcag
attgattgggagcatggggatggggtgtggagtatggagatgcttcctgttaagcgtacg
ttacagcacatgcgggagcgtggtgttaattttgtttatgggcgttggttaattgagggg
gctccgaaggtaattttgtttgatttggagtcagtgcgtcatcatctgagtgagtggaag
tcggatctctggacgactgcagggataccttctccggaggatgatatggagacaaacaac
gctattctgttgggctatacggtagcgtggtttttgggggagctagccgctcaggatcag
cgtcatgcgattgtggcgcactttcatgaatggttggcgggggtggctcttcctctgtgt
cgtagaagacgaattgatgtggtgacgatctttacgacgcatgcgacgttgttggggagg
catttatgtgctggtaatgcggatttttacaacaatttggatagttttgatgtggattcg
gaggcaggacggcgtgggatatatcattgctactgtattgagcgtgcggcggcgcatacc
gcagatgtgtttacgacggtttcgcagattactgcgtatgagtcagagcatttgttgaag
cggaagcctgatgggattttgcccaatgggctcaacgttatcaagtttcagactgtgcat
gagtttcagaatttgcatgctttgaaaaaggagaggattcatgattttgttcgtgggcat
ttccactggaattatgattttgacctcgataatacgttgtatttttttgttgccgggcgg
tatgagtatcgtaataagggggccgatatgttcatcgaggcgttggcacggttgaactat
cgtttgaaggcagcaggttcaaagatgacagtagtagcattcatcatcatgcctgctaaa
aaccgatcgtataccgtggaggcgttgcgcgggcaagcagtggttaaatcgctggagaat
accgttaaggatgttaccacgctgattggtaagcggttgtttgagcacgctgtgcgatac
ccacgtagcggtaaatccgaaatccctaacgagctgggggagttgttgaagccatcagat
atggtgctcttgaagaaacgtgtgtttgcgttgcgtagacctgaggggtcgctgcccccc
atagtaacacataacatggtcgatgatgctgcggacccgatcctaaaccaaattaggcgt
gttcaattgtttaaccattcttcagaccgtgttaaaattattttccatccagagttcttg
aacgctaataacccaattctgtctttggattacgatgaatttgtacgtgggtgccatttg
ggagtattcccttcttattacgagccatggggttatacccctgctgaatgtactgttatg
ggtgtcccctccatcactacaaatttgtcagggttcggtgcttacatggaggacttgatc
gaaagagatcaggcaaaggactatggtatctacatagtagaccgccgttttaaaagtccc
aacgagagtgttgaacaactcgtcgactacatggacgagttttgtaaaaagaccaggaga
cagagaatcaaccaaagaaatagaacagagcggctttctgatttgcttgactggaagcgt
atgggattagaatatgtgaaggcaaggcaattggccttgagaagagcttaccccgaagaa
tttatggccctggtgggtgaagatttggacgaccaggacatggattccttggccgggggt
caaaagtttaaagtcgcaagacctctctcggtccctgggtctccaagagatcgctctagt
tcaatgagtgcgatcctgatgacacctggcgatttaggtaccctgcaggatgcgaacaat
gcaaacgactacttccacttatcgatgcaagatgaggacgaaaacgatgaggaagatcaa
aactaa

DBGET integrated database retrieval system