KEGG   Eremothecium cymbalariae: Ecym_1385Help
Entry
Ecym_1385         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
erc  Eremothecium cymbalariae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ecym_1385
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Ecym_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(799629..800561)
Genome map
AA seq 310 aa AA seqDB search
MTNAAGMEVLNQPLHGIVIPSGLFIVGLAVIAWSVGDARYMLGLTILIIFLTFRLGIAYS
NRRSVLANKWTPLELEEQTLITRNAAIYRFKLKNSSETLDIATGFHLAVKVTVDNQEEIR
YYTPISNKFANGYFDIIVKSYVDGKVSKWFASLKPGQCVEFKGPVGRFSYVTNSFKRIGM
VTGGSAITPMLSVLNKIVTTPEDTTKVSLIYANETENDIMLKEELDELAKKYPNFEVHYV
LSKPRGSWNGDIGHVTKEHMQNYLPPPAAENRLLICGPPKMKQMLLSYASELGWPKGVLN
SKPDDQVFVF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgactaatgctgctggaatggaagtcctcaatcagccattacacgggattgtaattcca
agtggccttttcatagttgggctcgccgtgattgcttggtccgttggtgatgcgaggtat
atgttgggattgacaattcttattattttcctaaccttcagacttggtattgcatattca
aataggagatcagtcttagctaacaagtggactccattggagttagaagagcaaactttg
atcactaggaatgccgcgatttaccgttttaagttaaaaaacagctctgaaacgttagat
attgcaactgggttccacctcgcagttaaggttacagttgacaaccaagaggagatcaga
tattatacgcctatttcaaataaatttgcaaacggttactttgatataatcgttaaatca
tatgtcgatggtaaagtgtcaaaatggtttgcgagcttaaagccagggcagtgtgtggag
tttaaaggacccgttggaaggtttagttacgtcacaaactctttcaagagaatcggtatg
gttactggtgggtcagctatcactccaatgttaagtgtgcttaataaaattgttaccacg
cctgaggatactactaaggttagcttaatctatgctaacgagactgaaaacgacattatg
ctaaaagaagaattggatgaactcgccaagaagtatcccaactttgaagtacactatgta
ttatctaagccaaggggaagttggaatggggatattgggcatgttaccaaggagcatatg
caaaactacctcccaccacctgctgccgaaaacagactattgatatgtggacctcctaaa
atgaagcaaatgttactaagttatgcgagcgaattaggatggcccaaaggtgtcttgaat
tccaaacctgatgaccaagtatttgtattttga

DBGET integrated database retrieval system