KEGG   Eremothecium cymbalariae: Ecym_1473Help
Entry
Ecym_1473         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
erc  Eremothecium cymbalariae
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Ecym_1473
   00500 Starch and sucrose metabolism
    Ecym_1473
Enzymes [BR:erc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Ecym_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1:974120..975859
Genome map
AA seq 579 aa AA seqDB search
MIFSKLYSLVLLGSVATSSYVPYHASELVERDIDNTGKAADRPLIHATPDSGWMNDPNGL
WYDAKEKLYHLYYQYNPNDMVWGFPLCWGHATSEDLMLWKNHGVAISPARNDSGVYSGSA
VIDYNNTSGFFDDSVDPRQRVVAIWTYNTPESETQYLSYSTDGGYTFQEYEHNPVVEFNS
TQFRDPKVIWHEETQKWIMTVALCQQYSVFIYSSENLKDWTLESKFTDSGLLGFQYEAPG
LAKIPVTKATNNNYTLEDNSYDVKNNDTEYMWVLFLAINPGGPQGGSFNQYFIGDFNGTT
FTPFTHQTRMLDFGKDFYAFQGFFNSPDDSSYLGIAWTSNWQYSAYVPTYPWRSSMSLPR
RFTIQQYSPTPESVQLNLNSVPVLNLAGDDKPSESRYALSNKALNSTANLTIPIEGTPTG
TFEFTVTFACNSTTVVNTQSADLNFFLKGSKDQTEYLRLGHNAQAAAFFIDRGNTKVEFV
HSNPFFTNRLSVNGEPWSQDGSYSIYKVQGIVDVNILELFFNEGSMASTNTFFLSPGNFI
GNIEISSSVDGVYSILDFDLKELDVVDSKVTVETCGPSE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgatattctctaaactgtattcactggtactcttgggaagtgtcgccactagctcgtat
gttccatatcatgcctctgaattagttgaaagagacattgataatactggaaaagctgca
gacagacctttgattcatgccactccagatagcgggtggatgaacgatcctaacggtcta
tggtatgatgctaaggaaaaactataccatttgtactatcaatataatccaaatgatatg
gtttgggggtttccattatgctggggtcacgcgacgtctgaggatctgatgttgtggaaa
aaccatggtgttgcaatttcgcctgcccgtaacgattctggagtttactcaggttctgcg
gttattgattacaacaacacctctggtttttttgatgattctgttgacccacggcaaaga
gttgttgcaatttggacttacaatactcctgaatctgaaacacagtatctttcttattcc
actgatggtggttataccttccaggaatatgagcacaaccccgttgtggagttcaactct
acccagttcagagatcctaaggttatctggcatgaagagacccaaaagtggataatgaca
gttgcgttatgtcagcaatacagtgtgttcatttattcatctgagaatctaaaagactgg
acattagagtcgaagtttactgatagtgggcttttaggtttccagtatgaagcgcctgga
ttagcgaaaatacctgtcaccaaggcgactaacaacaactataccttggaagacaattca
tatgatgtcaagaacaacgatacagaatatatgtgggttctgtttttggctattaatcca
ggtggtccacagggaggttctttcaaccagtacttcattggtgactttaacgggaccaca
ttcacgcctttcactcatcaaaccagaatgcttgattttggtaaagacttttatgctttc
caaggtttcttcaatagccccgatgactctagctatcttggtattgcttggacgtctaat
tggcaatactctgcctatgtgccaacttacccttggaggtcatcaatgtctttgccaaga
aggtttaccattcagcaatattccccaactccagaaagtgttcagctaaacttgaactca
gtgccagtactaaaccttgctggtgatgacaaaccctctgaaagtaggtacgctctctct
aacaaggccttaaactcaaccgccaatttgactatccctatcgaaggtacccctactgga
accttcgaatttaccgtcactttcgcatgcaactccacaaccgtcgtcaatacccaatct
gccgacttgaatttcttcctaaagggttctaaagatcaaactgaatacttgagattgggc
cacaacgctcaagctgcagcattcttcatcgaccgtggaaacacaaaagtcgaattcgtc
cacagcaatccattcttcaccaacaggctatctgtaaacggcgaaccatggtcccaagac
ggctcttactccatttacaaagtccaaggtatcgttgatgttaacattctggagttgttc
ttcaatgaaggctctatggcttcaactaataccttctttttaagtcctggtaactttatt
ggcaacatagaaatatcaagttctgttgacggcgtttatagtatattagactttgactta
aaagagctggatgtcgttgattcaaaagtaaccgtcgagacctgcgggcctagcgagtga

DBGET integrated database retrieval system