KEGG   Eremothecium cymbalariae: Ecym_2022Help
Entry
Ecym_2022         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
erc  Eremothecium cymbalariae
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:erc03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(33898..34605)
Genome map
AA seq 235 aa AA seqDB search
MHRQKVRALISLLPPHHCVIIINMSVEEVTQKTQGLSVSENQEGQTVLSNSKDFNLKHPL
NSKWTLWYTKPPVGENESWSDLLRPVTSFTTVEEFWAIQQSIPRPRELPLKSDYHLFRDD
IRPEWEDEANSKGGKWSFQFKSARAPHIDDLWLRALLAVIGESIDEDDSEINGVVVNVRR
SGYKIGLWTKSVDQEPLSKVGAKFKAVLQLEESDKLEFFAHSSANDKNARPTLVL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcataggcaaaaggtaagagccttaatatctctgctaccccctcaccattgtgttata
atcatcaatatgtctgtagaagaagttactcagaagacgcaagggttgtccgtttcagaa
aatcaagaaggccaaactgtgctatctaacagcaaggacttcaatttgaaacatccatta
aactcaaaatggactctttggtataccaagcctccggtcggggaaaacgagtcttggtct
gatttattgcgcccggttacatcctttactactgttgaagagttttgggctatccagcag
tcgattcctagacctcgtgaacttcccttgaagtcggattaccatttattccgcgatgac
atcaggccagagtgggaagatgaggccaactccaagggaggtaagtggtctttccagttc
aaaagtgcaagggcgccacatatagatgatttgtggctaagggccctattggctgtcatt
ggtgaatctatcgatgaggatgattctgaaatcaacggtgttgtggtgaacgtgagaaga
tcagggtacaagattgggttgtggaccaagtctgtagaccaggagccattgtccaaggtt
ggtgcaaagtttaaggcggtgctgcagttggaggaatctgacaagttggaatttttcgct
cactcttctgctaacgataaaaacgctagaccaactctagttttgtag

DBGET integrated database retrieval system