KEGG   Eremothecium cymbalariae: Ecym_2034Help
Entry
Ecym_2034         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  
replication factor A2
Organism
erc  Eremothecium cymbalariae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ecym_2034
   03420 Nucleotide excision repair
    Ecym_2034
   03430 Mismatch repair
    Ecym_2034
   03440 Homologous recombination
    Ecym_2034
DNA replication proteins [BR:erc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Ecym_2034
DNA repair and recombination proteins [BR:erc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Ecym_2034
   MMR (mismatch exicision repair)
     Ecym_2034
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Ecym_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2:join(54071..54077,54156..54991)
Genome map
AA seq 280 aa AA seqDB search
MATYQQQPFNEYSSVSGGGFDNSQASAGKPNSAGGQTTATLTPVTIKQILEAKQFVQDGP
YVVNNIELHNICFVGVVRNVVDHTANVNVTVEDGTGQLEFRQWSNDQKDIERASQGEKGE
YNSEVSQQFQIGSYVKVFATLREFGGKMNIQYALVKPIENFNEVIAHHLSAIKCYALANG
KLAHPTSAVGTGTSTGQESNAQSLFVQDNDFSNAKPATQRILDFCRDQCRDKDANTFSVH
TKLIAQSLGMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatcaacagcaaccctttaatgaatattccagcgtttctggtggagggttt
gataattcccaggcttcagcgggcaaaccaaactcagcaggggggcagaccacagccact
ttgacccctgtgaccataaaacaaatactagaagctaaacaatttgtacaagatgggcct
tatgttgtaaataacattgagttgcataatatatgttttgtcggtgtggtaagaaacgtc
gtagaccacactgcaaacgtcaatgtgaccgtggaggatggaactgggcagcttgaattt
agacaatggagcaatgatcaaaaggatattgaacgagcaagccaaggcgagaagggcgag
tacaactccgaggtttcacaacaattccagattggatcttacgtcaaggtatttgccacg
ttaagagaattcggggggaaaatgaacatccagtatgcactagtaaagcctatagaaaac
tttaatgaagtgattgcccaccatctatcggccatcaagtgttatgcactagcaaacggt
aagctagcacatcccacatctgcagttggaacgggtacttccactggccaggagtcaaat
gcacagagcttgtttgtgcaagataacgatttcagcaatgcaaaacccgctacacaaagg
atcttggatttctgcagagatcaatgcagagacaaagatgcaaatacattttctgttcac
actaagttaattgcgcaatctctcggtatgttagaggacgatgtgagaatgcactgtcag
acactaaccgaacaaggtttcatatatcccacctttgatgagaacagctatttcacgtta
tga

DBGET integrated database retrieval system