KEGG   Eremothecium cymbalariae: Ecym_2034Help
Entry
Ecym_2034         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
erc  Eremothecium cymbalariae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Ecym_2034
   03420 Nucleotide excision repair
    Ecym_2034
   03430 Mismatch repair
    Ecym_2034
   03440 Homologous recombination
    Ecym_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(54071..54077,54156..54991)
Genome map
AA seq 280 aa AA seqDB search
MATYQQQPFNEYSSVSGGGFDNSQASAGKPNSAGGQTTATLTPVTIKQILEAKQFVQDGP
YVVNNIELHNICFVGVVRNVVDHTANVNVTVEDGTGQLEFRQWSNDQKDIERASQGEKGE
YNSEVSQQFQIGSYVKVFATLREFGGKMNIQYALVKPIENFNEVIAHHLSAIKCYALANG
KLAHPTSAVGTGTSTGQESNAQSLFVQDNDFSNAKPATQRILDFCRDQCRDKDANTFSVH
TKLIAQSLGMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatcaacagcaaccctttaatgaatattccagcgtttctggtggagggttt
gataattcccaggcttcagcgggcaaaccaaactcagcaggggggcagaccacagccact
ttgacccctgtgaccataaaacaaatactagaagctaaacaatttgtacaagatgggcct
tatgttgtaaataacattgagttgcataatatatgttttgtcggtgtggtaagaaacgtc
gtagaccacactgcaaacgtcaatgtgaccgtggaggatggaactgggcagcttgaattt
agacaatggagcaatgatcaaaaggatattgaacgagcaagccaaggcgagaagggcgag
tacaactccgaggtttcacaacaattccagattggatcttacgtcaaggtatttgccacg
ttaagagaattcggggggaaaatgaacatccagtatgcactagtaaagcctatagaaaac
tttaatgaagtgattgcccaccatctatcggccatcaagtgttatgcactagcaaacggt
aagctagcacatcccacatctgcagttggaacgggtacttccactggccaggagtcaaat
gcacagagcttgtttgtgcaagataacgatttcagcaatgcaaaacccgctacacaaagg
atcttggatttctgcagagatcaatgcagagacaaagatgcaaatacattttctgttcac
actaagttaattgcgcaatctctcggtatgttagaggacgatgtgagaatgcactgtcag
acactaaccgaacaaggtttcatatatcccacctttgatgagaacagctatttcacgtta
tga

DBGET integrated database retrieval system