KEGG   Eremothecium cymbalariae: Ecym_2034Help
Entry
Ecym_2034         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
erc  Eremothecium cymbalariae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:erc03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:erc03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:erc03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:erc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:join(54071..54077,54156..54991)
Genome map
AA seq 280 aa AA seqDB search
MATYQQQPFNEYSSVSGGGFDNSQASAGKPNSAGGQTTATLTPVTIKQILEAKQFVQDGP
YVVNNIELHNICFVGVVRNVVDHTANVNVTVEDGTGQLEFRQWSNDQKDIERASQGEKGE
YNSEVSQQFQIGSYVKVFATLREFGGKMNIQYALVKPIENFNEVIAHHLSAIKCYALANG
KLAHPTSAVGTGTSTGQESNAQSLFVQDNDFSNAKPATQRILDFCRDQCRDKDANTFSVH
TKLIAQSLGMLEDDVRMHCQTLTEQGFIYPTFDENSYFTL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggctacttatcaacagcaaccctttaatgaatattccagcgtttctggtggagggttt
gataattcccaggcttcagcgggcaaaccaaactcagcaggggggcagaccacagccact
ttgacccctgtgaccataaaacaaatactagaagctaaacaatttgtacaagatgggcct
tatgttgtaaataacattgagttgcataatatatgttttgtcggtgtggtaagaaacgtc
gtagaccacactgcaaacgtcaatgtgaccgtggaggatggaactgggcagcttgaattt
agacaatggagcaatgatcaaaaggatattgaacgagcaagccaaggcgagaagggcgag
tacaactccgaggtttcacaacaattccagattggatcttacgtcaaggtatttgccacg
ttaagagaattcggggggaaaatgaacatccagtatgcactagtaaagcctatagaaaac
tttaatgaagtgattgcccaccatctatcggccatcaagtgttatgcactagcaaacggt
aagctagcacatcccacatctgcagttggaacgggtacttccactggccaggagtcaaat
gcacagagcttgtttgtgcaagataacgatttcagcaatgcaaaacccgctacacaaagg
atcttggatttctgcagagatcaatgcagagacaaagatgcaaatacattttctgttcac
actaagttaattgcgcaatctctcggtatgttagaggacgatgtgagaatgcactgtcag
acactaaccgaacaaggtttcatatatcccacctttgatgagaacagctatttcacgtta
tga

DBGET integrated database retrieval system