KEGG   Eremothecium cymbalariae: Ecym_2095Help
Entry
Ecym_2095         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ecym_2095
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ecym_2095
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ecym_2095
Enzymes [BR:erc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ecym_2095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(170406..171938)
Genome map
AA seq 510 aa AA seqDB search
MSKGYRSTRSSENAVESFEHVVMKGLAPDGGLYIPSVIPQVSEGILFEEWSKLSFEELAL
EIMKLYISDSEIPETDLSGLIEKSYATFRSKEITPLMKNVTGAHENLHVLELFHGPTYAF
KDVALQFVGNLFEYFLQRTNKHLPVGQRKQLTVVGATSGDTGSAAIYGLKGKKDVSVFIL
YPTGRISAIQEEQMTTVHDKNVQTLSVKGTFDNCQDIVKGIFGDQEFTKKYHVAAVNSIN
WARILAQITYYFYAYFQTFSGKGEKVKFVVPSGNFGDILAGYFAKKMGLPIEKLVIATNE
NDILDRFLSCGIYERSDDVAATLSPAMDILISSNFERLLWYLVRDHISSGDDIEAGKVLN
TWFQQLKVNGRFEVNSDVLQGARKDFASARVSNSETIDTIRAIYTRSENPKKYIVDPHTA
VGICATRRHIEMDKDDTIQYISLSTAHPAKFANAVDEALSIFEGYSFENDVLPEELKKLS
VLDKKLRLVEKADLEEIKKVIEEELANMDL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagggttataggtctactaggtcgagcgaaaatgccgttgagtcgtttgaacat
gttgtcatgaaaggattggcacctgatggtggtttatatattccgtcggtgattcctcaa
gtgtcggaagggattttatttgaggaatggtccaagttatctttcgaagaactggctttg
gaaattatgaagttatatatatctgattctgaaattcctgaaacagatttgagcggattg
attgaaaagtcgtatgcaacttttcgttccaaggagattactcctctgatgaagaatgtt
actggtgcacacgagaatttgcatgttttagaactatttcatggaccaacgtatgctttc
aaagatgttgctctacagtttgttggtaatttgtttgaatattttttgcaaagaaccaac
aaacacttgcctgttggtcagagaaagcaattaacagttgttggtgctacttccggtgac
accggttctgcggctatttatggtctgaaaggaaagaaggatgtttcggtattcattctt
taccctactggtagaatatcagctatacaagaagagcaaatgactaccgttcatgataaa
aacgtgcaaaccttgtcagttaagggtacatttgacaactgtcaagacattgtcaagggt
atttttggtgatcaagagtttaccaagaaatatcatgttgctgctgtcaactcgattaac
tgggctagaatcttggctcaaattacttactacttttatgcttacttccagactttctcg
gggaaaggagaaaaggtcaagtttgttgttccatctggaaactttggtgatattttggct
ggttactttgccaagaagatggggttgcctatcgaaaagcttgtaattgcaactaatgag
aacgacatattagacagattcttgtcttgtggaatatatgaaagatctgatgacgttgca
gcaacgttatcaccagccatggacattttgatttcttctaattttgaaagattattgtgg
tatttggttcgcgatcacatttctagtggagatgatattgaagctggtaaagttttaaat
acatggttccaacaattaaaggtcaacggtaggtttgaagttaattcagacgtcctacag
ggggccagaaaagactttgcttctgccagggtatcaaactccgaaactattgataccata
agggctatttatacccgttcggagaacccaaagaagtacattgtggatcctcatactgct
gtcggaatttgtgccactcgcagacacattgaaatggacaaggacgatactattcagtac
atatcattatctacagcccatccagcaaaattcgccaatgctgtagatgaggctctctcc
atcttcgaaggctactcttttgaaaacgacgttctgccagaagaattgaagaagttatcg
gtcttggataaaaagttaaggctagttgagaaggccgatctagaagaaatcaaaaaggtc
atcgaagaggaactagctaatatggacctataa

DBGET integrated database retrieval system