KEGG   Eremothecium cymbalariae: Ecym_2114Help
Entry
Ecym_2114         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecym_2114
   01230 Biosynthesis of amino acids
    Ecym_2114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_2114
   00030 Pentose phosphate pathway
    Ecym_2114
   00051 Fructose and mannose metabolism
    Ecym_2114
   00052 Galactose metabolism
    Ecym_2114
  Energy metabolism
   00680 Methane metabolism
    Ecym_2114
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Ecym_2114
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ecym_2114
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ecym_2114
Messenger RNA biogenesis [BR:erc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Ecym_2114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:213297..216182
Genome map
AA seq 961 aa AA seqDB search
MAAEIPLVNGTNSFCVTAYSKQRYEQSISFYSNLLLMELASRGESSTILTNYALSVEIVY
NEDAVRDEETKALYKELSEAVTTVDWRAKSPSIVLSTVDTMRVRKQLDLCQLYPTELNPM
EVYTLDPQGNVIGFIKTKNAISTMPSGPNMKVLMSKSRLGSKPMSSVASSTDLRSGVLDT
SETYPSLPRKIGDKPGKAIAVMTSGGDSPGMNANVRAIVRTAIFKGCRAFTVMEGYEGLV
RGGPKYIKECTWEDVRGWSTEGGTNIGTARCMAFRERAGRLLGAQHLIEAGVDALIVCGG
DGSLTGADLFRSEWPSLIKELLAQGKISEEQVKKYQHLNICGTVGSIDNDMSTTDATIGA
YSSLDRICKAIDYIEATANSHSRAFVVEVMGRNCGWLALMAGIATSADYILIPEKPASSR
EWQDQMCDVVSKHRSRGKRTTIVIVAEGAIAADLTPVSPKDVHKVLVERLGLDTRITTLG
HVQRGGTAVAFDRILATLQGVEAVNAVLESTPNTPSPLIAINENQITRKPLRESVALTKS
VADAIKTKDFKKAMELRDSEFVEHLNNFMAINSADHNPPKLDADQALKIAVVNVGAPAGG
INSVVYSMAAYCMSQGHIPYAIYNGWTGLARHESVRTLNWKDMLGWQSRGGSELGTNRAT
PEDSDIGMIAYYFQKYKFDGLIIVGGFEAFISLNELEKARDSYPAFRIPMVLIPATLSNN
VPGTEYSLGSDTALNALMQYCDVVKQSAASTRGRAFVVDVQGGNSGYLATQAALAVGAQI
SYVPEEGISLEQLSQDIETLRESFDRAHGRGKFGKLILKSTNASKVFTTKTLADVITAEA
NGHFDAKPAVPGHVQQGGLPSPIDRTRGTRLAIRAVGFIESRQHIMKTKKFDEDNFDVND
KTISETAAVLGIKGSHIRFTSVRHLFDTETEFSKRMPKSIHWEGTRAIADHLEGRKKVAA
S
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgaaattccgttagtgaatggtacaaacagtttttgtgtaacggcatactcg
aagcaacggtatgagcagagtatctcgttttattctaatttgctactcatggaactagct
tccaggggtgaaagtagcacgattttgactaattatgcgttatccgttgaaatagtgtat
aatgaggatgctgtgcgtgatgaagagacgaaggcgttgtataaagaattaagcgaggcg
gtaacaacggttgattggagggcaaagtcgccttcaatagtgctctctactgtggataca
atgagggtaaggaagcagttggatttatgtcagttgtatcctacggagctaaatccgatg
gaggtgtatactttggatcctcaaggtaatgtgattgggtttattaagactaagaacgcg
atttcaacgatgcctagtggaccgaacatgaaggtgttgatgagcaaaagtcgccttggt
tcgaagccaatgtcgtcggtggcgtcttctacagatttgaggtctggggtgttagataca
agtgagacttatccttcactgcctaggaaaataggcgataaacctggcaaggcgattgct
gtgatgacatccggtggagattctccgggaatgaatgccaatgtgcgtgctattgttaga
acagctatctttaagggatgtcgtgcgtttaccgttatggagggatatgaggggttagtg
cgtggaggtcctaagtatattaaggaatgcacatgggaggatgtgaggggctggtcaact
gaaggtggaacgaatattggtactgcacgttgtatggcgttccgggagcgcgcgggtaga
ttgcttggcgctcagcatttgattgaggcaggtgttgatgctttaattgtttgcggtggt
gacggttcattgacaggtgcagaccttttcagatcagaatggccgtccttaattaaggaa
ttgttggcacaggggaagatcagtgaagagcaagttaagaagtatcaacatttgaacatc
tgtggtactgttggttctatagataatgatatgtccaccacggacgctacaatcggtgct
tattcttcattggatcgtatttgcaaggccattgattatattgaggcgacagctaattct
cactctagagctttcgttgttgaagtcatgggtagaaattgtggttggttggcgcttatg
gctggtattgctacctctgctgattatattttgattccagaaaagcctgcctcgtcgcgt
gaatggcaagatcaaatgtgcgatgtggttagcaaacacagatctcgtggcaagaggaca
actatcgtaatcgtagctgagggtgctattgctgctgatctcactccagtttcgccaaag
gatgtacacaaggtgctggtagaaagattgggcttggatacaagaatcacaacgttaggc
cacgttcaaagaggtggtactgctgtcgcgtttgatcgtatattagccactttgcagggt
gttgaagctgtaaatgctgtactagagtctactccaaacacaccatctcctttaattgct
atcaatgaaaaccaaattaccagaaagccattaagggagtcagttgctttgactaagtca
gttgctgatgcaatcaagaccaaagattttaagaaagcaatggagttgagagattctgaa
ttcgttgaacacttgaacaattttatggctatcaattcggcagatcataaccctcctaag
ttagatgcagaccaagcgttgaaaattgccgtagtaaatgttggtgctcctgcaggtggt
ataaactccgttgtttactccatggctgcctactgtatgtctcaaggccatattccttat
gctatctacaacgggtggacaggattggcaagacatgagtctgttcgtaccttaaattgg
aaagatatgctaggctggcagtctcgtggaggttctgagttgggtaccaatagagctacc
cctgaagattctgatataggtatgattgcgtactatttccaaaaatacaagtttgatggt
ttgattattgtaggcggatttgaagcgttcatttccctcaatgagttggaaaaggctaga
gacagttatccggccttcagaattccaatggttttaattcctgcaactctttccaataat
gttcctggcaccgagtattcattgggttctgacacagctttaaacgcattaatgcagtac
tgtgatgtagtcaagcagtctgccgcttctacccgaggcagagcgtttgtcgttgatgtc
caaggtggtaattctggctatttagccacccaagctgccctcgcggtcggtgctcaaata
tcctacgttccagaagaaggtatttcattggagcaattatctcaggatatcgaaactcta
cgggaatcctttgatagagcccacggcagaggtaaatttggtaagttgatcctgaagtcc
accaatgcctctaaggtgttcaccaccaaaaccttggctgatgtcatcactgctgaggcg
aatggccattttgacgcaaaacctgccgttccaggtcatgttcaacagggtggattgcca
tcaccaatagacagaacgagaggtaccaggttagccatcagagcagtgggtttcatcgaa
tctcgtcaacacatcatgaaaactaaaaaattcgatgaagacaacttcgacgtaaatgat
aaaactatttccgaaacagctgcagttttaggtattaagggatcccatatcaggtttact
tctgttagacatttgtttgacactgagaccgaattttctaagagaatgccaaagtcaatc
cactgggaaggtactagggctatcgcagaccacttagaaggtagaaagaaagtcgcagca
tcatga

DBGET integrated database retrieval system