KEGG   Eremothecium cymbalariae: Ecym_2203Help
Entry
Ecym_2203         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
erc  Eremothecium cymbalariae
Pathway
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:erc04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:401590..402648
Genome map
AA seq 352 aa AA seqDB search
MAMDFMGQQRYSTELVGADVQKRSLLPQRSTVSKGKYSLQDFQIMRTLGTGSFGRVHLVR
SIHNGRYYAIKILKKQQVVRMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMD
YIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDLKPENILLERNGHIK
ITDFGFAKEVDTVTWTLCGTPDYIAPEVITTKPYNKSIDWWSLGILIFEMLAGYTPFYDV
TPMKTYEKILLGKIVYPPFFHPDVVDLLSKLITEDLTRRLGNLQSGSQDIKSHPWFAEVI
WEKLLAKDIETPYEPPITAGVGDTSLFDQYPEEQFDYGIQEDDPYMRYFVDF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcaatggactttatgggacagcaaaggtattctacggaattggtcggggcagacgtt
caaaaacgatcgttacttccacagcggtcaactgtatccaagggaaagtatagtttgcag
gattttcagattatgcggacgttggggacgggttcttttgggcgtgtgcacttggtgcga
tcaatccacaatggtcgttattatgctataaagatattaaagaaacagcaggtggttcgg
atgaagcaaattgaacataccaatgacgaacgaaggatgctgaagttggtggagcatcca
tttttgattcggatgtggggtacttttcaggattccaggaatttattcatggttatggac
tatattgagggcggggagttgttttctcttttgaggaagtcgcagaggtttcctaaccct
gttgcgaagttctatgctgcggaggtgacattggcattggaatatctgcacgcccataat
ataatttatcgggacctgaaaccagaaaatattttattggaacgaaatggacatattaaa
attaccgatttcgggtttgccaaggaagttgatactgttacatggacgttgtgtggtact
cccgattacattgctcctgaggtaattacgacgaaaccttataacaaatcaatagactgg
tggtcgcttggaatattgatatttgaaatgctggccggctacacgccgttttatgatgtc
actccaatgaagacatatgagaaaatcttgctgggaaagattgtatatccgccattcttc
catccggatgtagttgatttgctgagtaagttaataacagaagacttaactcgcaggctg
ggtaatttgcagagtggttcacaagatataaaatcccacccttggtttgcagaggtgata
tgggagaagctgctggccaaagacattgaaaccccttacgaaccacctataactgctggt
gttggcgatacatcgctgttcgatcaatatccggaagagcaattcgattatggaatccag
gaggatgacccttatatgaggtattttgttgatttttaa

DBGET integrated database retrieval system