KEGG   Eremothecium cymbalariae: Ecym_2341Help
Entry
Ecym_2341         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
erc  Eremothecium cymbalariae
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Ecym_2341
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Ecym_2341
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Ecym_2341
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Ecym_2341
Transcription machinery [BR:erc03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Ecym_2341
Spliceosome [BR:erc03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Ecym_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(join(659309..660070,660529..660705))
Genome map
AA seq 312 aa AA seqDB search
METPPVDIDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
TMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVSRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAVK
PSAGRGKPKKKK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgcctcctgtggatattgataacatcattgacagattgttggaagttagaggg
tctaagcctggacagcaggtggatttagaggaacatgaaattcggtatctatgttcgaag
gcacggtctatttttattaagcagccgattctacttgagctagaagctcctattaaaatc
tgtggtgacattcatgggcagtattacgacttgctacgtttatttgaatatggtgggttt
cctccagaatccaactacctctttctaggtgattatgttgaccgtgggaagcagtccttg
gagacgatatgtctactgttagcttataagatcaaatatccagagaatttttttattctt
cgtggaaaccacgaatgtgcgtctatcaatagaatttatggtttctatgacgaatgcaag
aggcgttataacatcaagctatggaaaacctttacagactgtttcaactgtctaccaatt
gctgccatcatagacgaaaagatcttttgtatgcacgggggtctatctccagatttgaac
actatggaacaaattagaagagtcatgaggccaacagatattcctgatgtggggttgcta
tgtgatttattatggtctgatccggataaggatatcgttggttggtctgaaaatgataga
ggtgtttcttttacgtttggtccagacgtagtttcgaggtttctacagaagcaggatatg
gagttgatctgtagagcgcatcaagttgtggaggacggttatgagttcttttccaaaaga
cagttggttaccctatttagtgcaccaaactattgtggtgagtttgataatgcgggtgcc
atgatgagtgttgatgagagtttgttatgttccttccagattttgaaaccggctgtgaaa
ccaagtgccggtagaggcaaaccaaagaagaaaaaatga

DBGET integrated database retrieval system