KEGG   Eremothecium cymbalariae: Ecym_2346Help
Entry
Ecym_2346         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Ecym_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(678792..680249)
Genome map
AA seq 485 aa AA seqDB search
MFFEFSYKLYSHKPQTLHQITKYPRILEKQFEAVYIMSETFLYDAKTSQQQLPFEFGSSY
SPQVSYHFNPKVSQYHYGVRHPMKPFRLMLTDHLVSCYGLHKIMDLYETREATKEELLEF
HAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQGMFDYSILYAGASLDAARKLIN
NQSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISLLRYHPRVLYIDIDLHHGDGVQEA
FYTTDRVFTVSFHKYNGEFFPGTGDLDEIGCSKGKKFSLNVPLQDGIDDDSYINLFKSII
DPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIKAHGECVKFVKSFGIPILCVGGGGYTP
RNVSRLWAYETGVLNDVLLPSDIPKDIPFTDWFGPDYSLHPVLDDLYENKNSKKYLENIR
IRCLENLKYLQGAPSVRMDAELIPTQDLSGLTEEEEELIRDLNQEDELYRLEQIERENTR
RGELM
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgaattttcttataaactttactcacacaaacctcaaacattacatcaaata
actaaatatcctagaatacttgaaaagcagttcgaagcagtttacattatgtctgaaacg
ttcctatatgatgccaaaacatctcagcaacagcttccttttgaatttggttcatcttat
tctccacaagtttcatatcatttcaatcctaaagtatcacagtatcattatggtgttagg
catcctatgaaaccgtttagattgatgttaacagatcatttagtatcgtgttatgggttg
cataagattatggatctctatgagacgagggaggccactaaggaagagttgttagaattt
catgctccggattacatagaattcttgtctcatgtaacacctgagaacctaaacaaacta
cccagaggttccttggagaaatttaatattggagacgattgtcctatctttcaaggtatg
ttcgactacagcatcttatatgcgggagcatctttagatgcagcgaggaagttgatcaat
aatcaatcggaaattgctatcaattggtctggcgggttacatcatgccaaaaagagcaat
ccgtcagggttctgttatgtgaatgatattgtgttagcaataatcagcttgttgcggtat
caccccagagtgctatatatcgacatagatttacaccatggtgatggtgtgcaggaagca
ttctacacaacagaccgggtttttacggtatcgttccacaaatataatggggagtttttc
ccaggtacaggggatttagacgaaataggttgttctaaaggcaaaaagttttccttaaat
gttccattgcaggacgggattgatgatgattcatatattaatttgttcaagagtataata
gacccattagttacttcctacaagcccacagttatcattcaacagtgtggtgcagattca
ttggggcatgacaggttgggttgttttaatttaaacatcaaagcacatggtgagtgcgtt
aaatttgtaaaatcatttggtattcctatactctgtgtagggggcggtggctacacgccc
agaaatgtctcgcgcctatgggcatatgagactggtgtattaaacgatgtattgttacca
tcagatattcccaaggatattcctttcactgattggtttggtccagattattcattacat
cctgttctagatgatctttatgaaaataagaactcaaaaaaatatttggaaaatatacgg
atcagatgtcttgagaatttgaaataccttcagggcgctcctagtgtacgtatggatgca
gaattaataccaactcaggatctttctgggttaacggaagaagaggaggaactgatacga
gacttgaaccaggaggacgagctttatagattggaacaaatagaaagggaaaatactcgt
cgaggagagttaatgtaa

DBGET integrated database retrieval system