KEGG   Eremothecium cymbalariae: Ecym_2400Help
Entry
Ecym_2400         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ecym_2400
Chromosome [BR:erc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Ecym_2400
   HAT complexes
    TIP60 complex
     Ecym_2400
    NuA4 complex
     Ecym_2400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(779541..780848)
Genome map
AA seq 435 aa AA seqDB search
MANEEEKELGISKYIEDVDDVVIGCKCWVEKDGEQRLAEILSISNRRQPPKFYVHYEDFN
KRLDEWILSSRINFKREVTYPKPKDPDEKKKKKQKKSTTPQVIEGETPDEADIMDLENLN
VQGLRDEGISRDDELKKLRTSGSMTQNPHEVARVRNLSKIIMGKHEIEPWYFSPYPIELT
DEDVVYIDDFSLQYFGSKKQYERYRTKCTLRHPPGNEIYRDDYISFFEIDGRKQRTWCRN
LCLLSKLFLDHKTLYYDVDPFLFYCMTHRDDLGHHLVGYFSKEKESADGYNVACILTLPQ
YQRMGYGRLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLIKLLVENGSEVTI
DEISNMTSMTTTDILHTAKALNILLYYKGQHILFLNEDVLLQYEKLLAKKKRSINPERLM
WKPPVFTASQLRFAW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgaggaggagaaagaacttggaatttctaaatacatagaggatgttgatgat
gttgttattggttgcaagtgctgggttgaaaaagatggagaacaacgtttagcagaaatt
ttatcaatcagcaacagaagacaacctccaaagttttatgttcattatgaagacttcaac
aagagattggatgagtggattttatcttcgaggataaattttaaacgagaagtgacatat
cccaaaccaaaagatccagatgaaaagaagaagaagaaacagaagaagagtacaactccg
caagttatagagggagagactcccgatgaagcagatattatggatttagagaacttgaat
gttcaaggtttacgagatgaaggaataagtagagacgatgagctcaaaaagttgaggact
tccggctctatgacacagaatccgcatgaagtggctcgggtgagaaatttaagcaagata
attatggggaaacatgagatagagccatggtatttttccccatatcccatcgaacttacc
gatgaagatgtggtatacattgatgatttttcgttgcagtattttggatccaaaaagcaa
tatgaaaggtatagaactaagtgtactctacgacatcctccaggaaatgagatttaccga
gatgactacatttcattttttgaaatagatggtaggaaacaaagaacgtggtgcagaaac
ctatgtctgttatcaaagctattcttagatcataaaacattatactatgatgttgatccg
ttcctattttattgtatgacccatagagatgatttgggacatcatttagttggttacttt
tccaaggaaaaggaatctgcagacggttataacgttgcatgcatcttaacattacctcaa
taccaaagaatgggttatggccgcctgctaatcgagttttcgtatgagttatctaaaaag
gaaaacaaagttggatccccagaaaaaccgttatctgatctgggactcctttcgtataga
gcatattggtcggatacattaatcaaattactagtagaaaacggatctgaagttacgatt
gatgaaatcagcaacatgacttctatgaccacaacagatatattgcacactgcaaaagct
ttgaatattctgctatattacaagggccaacatatacttttcctcaatgaagatgtattg
ctgcaatatgaaaagttgctggccaagaagaaaaggtcaataaaccccgaaaggttgatg
tggaaaccgcctgtttttaccgcgtctcaattaagatttgcttggtaa

DBGET integrated database retrieval system