KEGG   Eremothecium cymbalariae: Ecym_2551Help
Entry
Ecym_2551         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ecym_2551
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Ecym_2551
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ecym_2551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1068369..1069994)
Genome map
AA seq 541 aa AA seqDB search
MLEKGNDYYVADIEANSLVPKKARKRWLVAMKWVVFCIVLRCVFWFAFDYDFMGRYQEAG
SKRNVIFFVTDGMGPASLTLTRGFLQNEKNDTTEMYFSGLGVNSYLVGTSRTRSSSSYIT
DSAAGATAFSCGLKTYNGAVGVDAAQQPCGTVLEAAKLQGYMTGMVVTTRITDATPGAYS
AHVDNRGQEELIAEQQLGGYPLGRVVDLIIGGGRKFFFGSNERKYGGEYGARRDERDLIE
EAVVNGWQYVGDTAQFRELQGGKNVSLPLLALLAHEDLPYSIDRDAERQDWPSFTEQVKT
AVRALTEATKDSDKGFFLLVEASRIDHAGHTNDPGTQAREVMGFDDAFQWTVAHAKNSNV
ETLIISTSDHETGGLSVGRQLDQNEIQYYWDPEVLSRMKHSCDYFGKEIMSFKESNADPA
QLREFVRETVFKDGLGIRDVADSDVNLIVGLDDFAQLVNELGLIVSVRAYIGWSTHGHSG
VDVNVYAYANKMSAKHLIRKNLSGNRENTDIGQFVIDYLSLDVAAVTDMLKDTKHSPDKG
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttggaaaagggtaatgattattatgttgcggatatagaggccaattcgctggttcca
aagaaggctcgcaagcggtggcttgtggccatgaagtgggtggtgttctgcattgtgttg
cgctgtgttttctggtttgcgtttgactatgactttatgggaagatatcaagaggctgga
tcgaaaagaaacgtaatattttttgttacagacggtatggggccggcttcattgacgttg
acaagagggttcttgcagaatgagaagaatgatacaacagagatgtatttcagcgggctt
ggcgtaaacagttatttggtagggacttcgcggacgcgttcgtcgtcttcgtatatcaca
gattcagcggcgggtgccacggcgttttcgtgtggcttgaagacgtataacggggcggtg
ggtgtggatgcagcgcagcagccgtgtggtacggttttggaggcagcgaagctgcaaggg
tacatgacggggatggtggtgactactaggatcacagatgcaactccgggggcgtattct
gcccatgtggataatcggggacaggaggaacttattgcagagcagcaattgggggggtat
cctcttggacgtgtggtggatttgataatcggtggtggtagaaaattcttttttggtagt
aatgagaggaaatatggaggggaatacggagcacgtcgggatgagcgcgatttaatagaa
gaggcagttgttaacggctggcagtacgtcggcgacactgcacaattccgggagttacag
ggcggtaaaaacgttagtcttccattgttggctttgttggctcatgaagacttaccatat
tctatagatagggatgcagagagacaagattggcccagtttcacagagcaagttaagaca
gcagtgagggctttgacagaggctacaaaggactcagataagggtttctttttgctggtg
gaggcctccagaatcgatcatgcaggtcatacgaacgatccagggacccaggctagggag
gttatgggttttgatgatgcctttcaatggactgtggctcacgctaagaattccaacgtt
gaaacattgataatctctacttcagatcatgagactggcggtctctccgttggaagacag
ctagaccaaaatgaaatacaatactactgggatccagaagtattgagtcgcatgaagcac
tcatgcgactattttggaaaggaaattatgagttttaaggaatccaatgctgaccctgcc
caattgagggaatttgttagggagacggttttcaaagatggtcttgggattcgcgatgtt
gcggactcagatgttaacctaatcgtggggttagatgactttgcgcagcttgttaatgaa
ttgggcttgattgtatctgtccgcgcgtatattgggtggagtacccacggtcatagtggt
gtggacgttaatgtttatgcatatgctaacaaaatgtctgccaaacatctaattcgtaag
aacttgtctggtaatcgtgagaatactgatataggccaatttgtcatagattacctatcc
ttggatgtggcagcagttacagatatgcttaaggacacaaaacactcacctgataaagga
aactga

  All links  
No link information was found.   
DBGET integrated database retrieval system