KEGG   Eremothecium cymbalariae: Ecym_2647Help
Entry
Ecym_2647         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
erc  Eremothecium cymbalariae
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:erc01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:erc00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:erc00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:erc00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1253640..1255172)
Genome map
AA seq 510 aa AA seqDB search
MRRNGYGHNHTFEITKRINRVSFIICTSGDCKTMLRQALKQLYNRKNMSSVVEFTVNNTA
RRITLNRSKKLNALDYEMCAVIFPAVQEYAKSDVNNVIIIDSSSSPRAFCAGGDVAALSK
ELLKGNSSVANTYFQAEYSLNWLLATMEKPVVAIMDGITMGGGVGLCIHVPFRVATENTL
WAMPESAIGLFADVGTTFGLPRVVTLGGSECQLGYFVCITGDILSGADAYVAGLASHYVD
SAHVADLQTRLGELQPNKDADLMFEITNKAIGEFSTPLPKDYKFKYSAAQLDVIEKVFRL
DTPLKDVFKSLEEISASPSWSKEAQEFAKETRDKLSLKSIVSMEVTREQFRRNFFNDIQT
AMKQDLITATNMCNFQELTEFAKATSHKLLERKKTPYNWEVKDISMGALSRILSPNPENP
VSLLDIGSVTFKKYMHHEKFILPNEDKVQAYIVGSDQSGRSMAVTKPEAIRYFTEFNPST
KGKVGVEYIVGFIIDRKCETDRDGFLKWKY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaatggatacgggcataatcatacgtttgaaataaccaaaaggatcaaccgg
gtttccttcattatatgtacatctggagattgtaagacgatgctcagacaagcattgaag
cagttatacaataggaaaaatatgtcgtcggttgtggaattcacggtgaacaatacagcg
aggaggatcacgctgaaccggtctaagaagctaaatgcgttggattatgagatgtgtgcg
gtgattttccctgctgttcaggagtatgccaagagtgatgtcaacaatgtgatcataatt
gattcttcaagtagtcccagagcgttttgtgctgggggggacgttgcggcactttctaag
gagctgttgaagggaaattcttctgttgcgaatacgtacttccaggctgaatactctttg
aactggcttttagctacgatggagaagcccgttgttgccataatggatgggatcaccatg
ggtggaggagttgggttgtgtattcatgtgccattccgcgttgctactgaaaacactctc
tgggcaatgcctgaatctgcaattgggcttttcgcagatgttggaaccacgtttgggttg
ccaagagtggtcacgcttggtggttccgagtgtcaacttggatactttgtgtgtattacg
ggggacatcttgagtggtgctgatgcatacgtcgcaggcctggcctcgcattatgttgat
agtgcgcatgttgcggatcttcaaacaagactgggtgagttgcagccaaataaagacgcc
gatcttatgtttgagattacaaataaggcaattggggaattttccacacctttaccaaag
gattataaatttaaatattcagcagctcagctggacgtcattgaaaaggttttccgtctc
gataccccgttgaaggatgtattcaaatcgttggaagagatttctgcatcaccatcatgg
tccaaagaggcacaagagtttgccaaagaaactagagacaagctctccctaaagtcgata
gtttcaatggaggttaccagagaacagttccgcagaaactttttcaacgatattcaaact
gccatgaagcaagacttaatcactgctacaaatatgtgcaactttcaggaattgaccgaa
tttgcgaaagcgacatcacacaaattacttgaaagaaagaaaaccccttacaactgggaa
gttaaagatatttcaatgggggctctgtcacgtatactatccccaaatcctgagaatccc
gtatcattacttgatattgggagtgttacctttaagaagtacatgcatcatgagaagttc
atattgccaaatgaagacaaagttcaagcctatatagttggttcagatcaatctggaaga
tctatggctgtaaccaaaccagaagctattagatacttcactgaatttaacccttcgact
aagggtaaagtcggtgtagaatatattgtcggtttcatcattgacagaaaatgtgagact
gatcgtgatggttttctaaaatggaaatattag

DBGET integrated database retrieval system