KEGG   Eremothecium cymbalariae: Ecym_2647Help
Entry
Ecym_2647         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00280  Valine, leucine and isoleucine degradation
erc00410  beta-Alanine metabolism
erc00640  Propanoate metabolism
erc01100  Metabolic pathways
erc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ecym_2647
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ecym_2647
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ecym_2647
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     Ecym_2647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 Topoisom_I_N
Motif
Other DBs
NCBI-GeneID: 11468416
NCBI-ProteinID: XP_003645175
UniProt: G8JNT3
Position
2:complement(1253640..1255172)
Genome map
AA seq 510 aa AA seqDB search
MRRNGYGHNHTFEITKRINRVSFIICTSGDCKTMLRQALKQLYNRKNMSSVVEFTVNNTA
RRITLNRSKKLNALDYEMCAVIFPAVQEYAKSDVNNVIIIDSSSSPRAFCAGGDVAALSK
ELLKGNSSVANTYFQAEYSLNWLLATMEKPVVAIMDGITMGGGVGLCIHVPFRVATENTL
WAMPESAIGLFADVGTTFGLPRVVTLGGSECQLGYFVCITGDILSGADAYVAGLASHYVD
SAHVADLQTRLGELQPNKDADLMFEITNKAIGEFSTPLPKDYKFKYSAAQLDVIEKVFRL
DTPLKDVFKSLEEISASPSWSKEAQEFAKETRDKLSLKSIVSMEVTREQFRRNFFNDIQT
AMKQDLITATNMCNFQELTEFAKATSHKLLERKKTPYNWEVKDISMGALSRILSPNPENP
VSLLDIGSVTFKKYMHHEKFILPNEDKVQAYIVGSDQSGRSMAVTKPEAIRYFTEFNPST
KGKVGVEYIVGFIIDRKCETDRDGFLKWKY
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaggagaaatggatacgggcataatcatacgtttgaaataaccaaaaggatcaaccgg
gtttccttcattatatgtacatctggagattgtaagacgatgctcagacaagcattgaag
cagttatacaataggaaaaatatgtcgtcggttgtggaattcacggtgaacaatacagcg
aggaggatcacgctgaaccggtctaagaagctaaatgcgttggattatgagatgtgtgcg
gtgattttccctgctgttcaggagtatgccaagagtgatgtcaacaatgtgatcataatt
gattcttcaagtagtcccagagcgttttgtgctgggggggacgttgcggcactttctaag
gagctgttgaagggaaattcttctgttgcgaatacgtacttccaggctgaatactctttg
aactggcttttagctacgatggagaagcccgttgttgccataatggatgggatcaccatg
ggtggaggagttgggttgtgtattcatgtgccattccgcgttgctactgaaaacactctc
tgggcaatgcctgaatctgcaattgggcttttcgcagatgttggaaccacgtttgggttg
ccaagagtggtcacgcttggtggttccgagtgtcaacttggatactttgtgtgtattacg
ggggacatcttgagtggtgctgatgcatacgtcgcaggcctggcctcgcattatgttgat
agtgcgcatgttgcggatcttcaaacaagactgggtgagttgcagccaaataaagacgcc
gatcttatgtttgagattacaaataaggcaattggggaattttccacacctttaccaaag
gattataaatttaaatattcagcagctcagctggacgtcattgaaaaggttttccgtctc
gataccccgttgaaggatgtattcaaatcgttggaagagatttctgcatcaccatcatgg
tccaaagaggcacaagagtttgccaaagaaactagagacaagctctccctaaagtcgata
gtttcaatggaggttaccagagaacagttccgcagaaactttttcaacgatattcaaact
gccatgaagcaagacttaatcactgctacaaatatgtgcaactttcaggaattgaccgaa
tttgcgaaagcgacatcacacaaattacttgaaagaaagaaaaccccttacaactgggaa
gttaaagatatttcaatgggggctctgtcacgtatactatccccaaatcctgagaatccc
gtatcattacttgatattgggagtgttacctttaagaagtacatgcatcatgagaagttc
atattgccaaatgaagacaaagttcaagcctatatagttggttcagatcaatctggaaga
tctatggctgtaaccaaaccagaagctattagatacttcactgaatttaacccttcgact
aagggtaaagtcggtgtagaatatattgtcggtttcatcattgacagaaaatgtgagact
gatcgtgatggttttctaaaatggaaatattag

DBGET integrated database retrieval system