KEGG   Eremothecium cymbalariae: Ecym_2678Help
Entry
Ecym_2678         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
erc  Eremothecium cymbalariae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ecym_2678
Enzymes [BR:erc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Ecym_2678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1310658..1313417)
Genome map
AA seq 919 aa AA seqDB search
MSYRSSLQSYQNKPFKAPKMAGKLSSQCEVDNISSQGQDAKYVVPITISETNAKSEVEQT
KKRKLNARLYMITFRKSSTKKNKTWDGDGYGLISASEEHITLYNEGGKRLGTHPWYLNKD
MSDLILKCGSGWECQLDYEITDTKEYADTLRLLKPQGSISDSDKEGLHIARRNPTAFPSL
SGPKDANVPTRVPISKLFTPTIETKFRSVLKQSESTAALTSNSSLRNGDKTYQALFDKTK
IENPLVMNRAVDDEVEIIVDPLLSKTLRPHQRIGVKFMYDCIRGLSRPENDDVQKDITLE
YDGDIKGCLLADEMGLGKTYMTITLIWTLLKQHPKPSNVPCSQSGVALQGMCHKILVVCP
VTLIGNWKKEFTKWLPLNKIGVLTLSNKNTPEKDKSDVRNFLRVQRTYHVLILGYEKLLA
VVSELEQGKNKLGLLVCDEGHRLKNANSKILKCLTDLDIDRKVILTGTPIQNDLNEFYTI
INFINPGILGSFSCFKRTYINPITRARDVNNRFSEKIQSLGESKSQDLIEITKRFTLRRT
SSIIANYLPPKTDLVIFCKPTVHQIETFKMLLLAGQIDFQRLQTSSSLGLITLFKKVCNS
PSLISSDPYYQNTIQNHGKFAKLVNSIDSGKLKVLMSLLSHIRNNTDGEKVVIVSNYTQT
LDIIQGLMASSSLSFVRLDGSTPAKERDSIVSLFNSSPNVFGFLLSAKSGGVGLNLIGAS
RLILFDNDWNPSVDLQAMSRIHRDGQKRPCFIYRLVTTGCIDEKIFQRQLMKNNLSKKFL
DNHLDEKTNDNLFEKEDLKDLFTIQTATKCNTHDLICSCPGLGHQFEEKDLCKPHSADKE
STSEVNTDGWMCASDFKDMVEEHQKEASALKNELMRKCLVGYRHINPELIADLRDPIIER
TLVDLPNVMTFAFVCSSIE
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtcatataggtcgtctttacaaagctatcagaataaaccatttaaggctcctaaaatg
gcgggtaaattatcatcacaatgtgaagtggacaatatctcttctcagggccaggatgca
aaatatgtagtaccgataacgatatccgagaccaatgctaagtctgaagttgaacagact
aaaaaacgcaaattgaatgctcgattgtacatgataacatttaggaagagcagtaccaag
aagaacaagacgtgggatggtgatggctatggactcatatcagctagtgaggaacacata
acgttatacaacgagggtggaaaacgtctaggcacacatccgtggtatctcaataaagat
atgagcgatctgatcttgaagtgcggttcaggctgggaatgtcagttggattatgagatc
acagatacgaaggaatacgctgatactttacggcttttaaaaccacaaggctcaatatct
gactccgataaagaaggcttgcatattgcgcgacgtaatcccacagcatttcctagcctt
agcggtccaaaagacgccaatgtcccaaccagagtccccatatctaaattattcactcca
acaattgaaaccaaatttaggtctgtacttaaacaatcagagtcaactgcagcactgaca
agcaatagctctcttagaaatggtgataaaacttaccaggctctctttgacaaaacgaaa
atagaaaacccgctagttatgaacagagcagttgatgatgaggtggaaattattgttgat
ccactactttcaaaaaccttgaggccacatcaaagaattggtgttaaatttatgtatgat
tgcattagagggttgtcgaggccagaaaatgacgatgtgcaaaaggatattacattagaa
tacgatggtgatattaaagggtgtttattggctgatgaaatgggattagggaagacatat
atgaccataacattgatatggacgctgttaaaacaacacccaaagccttcaaatgtaccg
tgttcgcagagtggagtagcattgcaaggaatgtgccacaaaatactcgttgtatgtccc
gtaactttaataggtaattggaagaaggaatttacaaaatggctaccattgaacaagatt
ggtgttctgacactaagcaacaaaaacacgccagagaaggataaatctgacgtaaggaat
ttcctaagagtacagagaacctaccatgtattgattcttggttatgaaaaattgttggcc
gtggtttctgaattggaacaaggaaagaataaactaggacttttggtatgtgatgaagga
catagactgaaaaatgcaaattctaagattttgaagtgtttgactgatttagatatcgac
aggaaagtaattttaacaggtacaccaatacaaaatgatttaaatgaattttacactatc
attaactttatcaatccaggcatattgggttcattctcatgtttcaaaagaacatatatc
aatcctataactagggcaagagatgttaacaatagatttagtgaaaagatacaatctttg
ggtgagtcgaaatcccaggatttgatagaaattaccaaaaggtttactttaagaagaact
agctctattattgcaaactatttacctcccaaaacagacctagtaattttttgtaaacca
acagtgcatcagattgaaaccttcaaaatgttattattagcaggccagatagattttcaa
agactacaaacctcatcatcattaggtctaattacactttttaaaaaagtatgcaattct
ccaagtttaataagttcagacccttattatcaaaacacaatccaaaaccatggaaaattt
gcaaaattagtgaactccatagattcaggaaaactaaaggttttaatgtcattgttaagt
catattaggaacaataccgacggtgaaaaggttgttattgtttctaattatacccaaacg
ttagatattatccaaggattaatggcctcatcaagtctctcatttgtacggcttgatgga
tctactccagctaaagagcgtgactctatcgttagcttgttcaattcaagccccaatgta
tttggctttctgctcagcgccaaatctgggggcgtggggctaaatttaattggtgcatct
cggctaatattatttgataatgattggaatccatctgtggatcttcaagctatgtcaaga
attcatagagatggtcaaaaaaggccatgcttcatttatagacttgtcactacaggctgt
attgacgagaaaatcttccaaagacaattaatgaagaataatttgagcaagaagttctta
gacaatcatttagacgaaaagactaacgataatttattcgagaaagaagatttaaaagat
ttatttactatccagacggcgacaaaatgtaatacgcatgatcttatttgttcatgtccg
ggacttgggcatcagttcgaggaaaaagacctttgcaagcctcactctgctgataaagaa
agtactagcgaagttaatacggatggttggatgtgtgcatctgacttcaaagatatggta
gaagagcatcaaaaagaagcgtcagccttaaagaacgaattaatgagaaagtgtctagtt
ggctataggcatataaaccctgaattaattgcggatctcagagatccaatcattgaaaga
acattagtcgatctccctaatgttatgacttttgcatttgtgtgttcaagtatagaatga

DBGET integrated database retrieval system