KEGG   Eremothecium cymbalariae: Ecym_2717Help
Entry
Ecym_2717         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1388844..1390295
Genome map
AA seq 483 aa AA seqDB search
MSVNIKHAGKVYPMKLSATTTGADLRESVERLVQIPSSRQKYMIKGGLIDDVLVSDVIKP
GANVMLLGTPDKDLIVKPKNTEKFIEDLDKNEQGQHLSKMPMGIANLGNTCYMNATLQGL
FRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLKDRKGENITPLLLLEILRR
VFPQFSETDPQGGFYKQQDAEELFTQLFHTLKTVFGSKLMDNFQIDFRTTLQDTTNESDV
IEKVEDDLKLQCHITGATNFMKSGIKESLRENITKRSELTGASSTYSVEKKITKLPAYLT
VQYVRFFWKKSTGKKSKILRKVQFPFQLDVADLLDSDYAQEKIKVRDAIREVHKERVDEN
AEVKRAQENVSSPSATQALASISSTAESRNERWATEVKALSPPDLRPGENPSCIYDLIGV
ITHQGANSESGHYQAFIRDDADEKWYRFDDDKVTAIEKEKIESLAGGGESDSALILIYKG
LGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaatatcaaacatgcaggcaaggtttatcctatgaaattgtctgcaaccaca
acaggggcagatttaagggaatcagtagagagattagtccaaattcctagcagcagacaa
aaatatatgataaaaggtggattgatagatgatgttttggttagcgatgtgatcaaaccg
ggtgcgaatgtgatgttattaggtacacctgataaagatctaatagtcaaacccaaaaat
actgagaaatttatcgaggatttggataagaatgaacagggacaacatctgagcaaaatg
ccaatgggcattgcgaatcttggcaacacttgttacatgaatgcgacattgcagggattg
tttcgcattgatccgttgcgggaacaagtcctggaatttgatgagaagcgtgctataaaa
gaaggcgttgacacctatcatgcccagcttgtgcgtgaactcaaggtcacatttcaaaaa
ttgaaagacagaaagggagagaatattaccccgctattattattggagattctaaggaga
gtattcccacagttttcagagacagacccacagggagggttctacaaacagcaggacgcc
gaagagttatttacacagttatttcatactttgaagacagtatttgggagcaaactaatg
gataactttcaaattgacttcaggaccactttgcaggatactacgaacgaatcagacgtc
attgagaaggttgaagacgatttgaagttacagtgtcatattactggtgcgactaatttt
atgaaatctggtattaaagaatccttaagagaaaatataacaaaacgttctgaactaact
ggtgctagttccacttacagcgttgagaagaagattaccaaattaccagcttatttaact
gtgcagtacgttcgttttttctggaagaagtccactggcaaaaaatccaaaatcttgcgc
aaggtccagttcccatttcagcttgacgtcgctgaccttttagactccgactacgcccaa
gaaaagatcaaagtcagagatgctatcagagaagtccataaagagcgtgtagatgagaat
gcagaagtaaaacgcgctcaggaaaacgtttcttccccctcggcaacacaagcgttggcg
tctatttcttccacggcagagagtagaaacgaacgctgggcgaccgaggttaaggccctg
tctccccctgatctacgtccaggtgaaaatccttcctgcatttatgatcttattggtgtc
attacccatcaaggggctaactctgaatctggtcactatcaggccttcatcagagatgat
gccgatgagaaatggtacaggttcgacgacgataaagtcactgcaatcgaaaaggaaaag
atagagtctcttgcgggtggtggtgaaagcgatagtgctctcatccttatatataaggga
cttggcttatga

DBGET integrated database retrieval system