KEGG   Eremothecium cymbalariae: Ecym_2717Help
Entry
Ecym_2717         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ecym_2717
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ecym_2717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1388844..1390295
Genome map
AA seq 483 aa AA seqDB search
MSVNIKHAGKVYPMKLSATTTGADLRESVERLVQIPSSRQKYMIKGGLIDDVLVSDVIKP
GANVMLLGTPDKDLIVKPKNTEKFIEDLDKNEQGQHLSKMPMGIANLGNTCYMNATLQGL
FRIDPLREQVLEFDEKRAIKEGVDTYHAQLVRELKVTFQKLKDRKGENITPLLLLEILRR
VFPQFSETDPQGGFYKQQDAEELFTQLFHTLKTVFGSKLMDNFQIDFRTTLQDTTNESDV
IEKVEDDLKLQCHITGATNFMKSGIKESLRENITKRSELTGASSTYSVEKKITKLPAYLT
VQYVRFFWKKSTGKKSKILRKVQFPFQLDVADLLDSDYAQEKIKVRDAIREVHKERVDEN
AEVKRAQENVSSPSATQALASISSTAESRNERWATEVKALSPPDLRPGENPSCIYDLIGV
ITHQGANSESGHYQAFIRDDADEKWYRFDDDKVTAIEKEKIESLAGGGESDSALILIYKG
LGL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaatatcaaacatgcaggcaaggtttatcctatgaaattgtctgcaaccaca
acaggggcagatttaagggaatcagtagagagattagtccaaattcctagcagcagacaa
aaatatatgataaaaggtggattgatagatgatgttttggttagcgatgtgatcaaaccg
ggtgcgaatgtgatgttattaggtacacctgataaagatctaatagtcaaacccaaaaat
actgagaaatttatcgaggatttggataagaatgaacagggacaacatctgagcaaaatg
ccaatgggcattgcgaatcttggcaacacttgttacatgaatgcgacattgcagggattg
tttcgcattgatccgttgcgggaacaagtcctggaatttgatgagaagcgtgctataaaa
gaaggcgttgacacctatcatgcccagcttgtgcgtgaactcaaggtcacatttcaaaaa
ttgaaagacagaaagggagagaatattaccccgctattattattggagattctaaggaga
gtattcccacagttttcagagacagacccacagggagggttctacaaacagcaggacgcc
gaagagttatttacacagttatttcatactttgaagacagtatttgggagcaaactaatg
gataactttcaaattgacttcaggaccactttgcaggatactacgaacgaatcagacgtc
attgagaaggttgaagacgatttgaagttacagtgtcatattactggtgcgactaatttt
atgaaatctggtattaaagaatccttaagagaaaatataacaaaacgttctgaactaact
ggtgctagttccacttacagcgttgagaagaagattaccaaattaccagcttatttaact
gtgcagtacgttcgttttttctggaagaagtccactggcaaaaaatccaaaatcttgcgc
aaggtccagttcccatttcagcttgacgtcgctgaccttttagactccgactacgcccaa
gaaaagatcaaagtcagagatgctatcagagaagtccataaagagcgtgtagatgagaat
gcagaagtaaaacgcgctcaggaaaacgtttcttccccctcggcaacacaagcgttggcg
tctatttcttccacggcagagagtagaaacgaacgctgggcgaccgaggttaaggccctg
tctccccctgatctacgtccaggtgaaaatccttcctgcatttatgatcttattggtgtc
attacccatcaaggggctaactctgaatctggtcactatcaggccttcatcagagatgat
gccgatgagaaatggtacaggttcgacgacgataaagtcactgcaatcgaaaaggaaaag
atagagtctcttgcgggtggtggtgaaagcgatagtgctctcatccttatatataaggga
cttggcttatga

DBGET integrated database retrieval system