KEGG   Eremothecium cymbalariae: Ecym_2815Help
Entry
Ecym_2815         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
erc  Eremothecium cymbalariae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ecym_2815
Enzymes [BR:erc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ecym_2815
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     Ecym_2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1579747..1584321
Genome map
AA seq 1524 aa AA seqDB search
MRRFLLRLGDGGEPVESCSNGKGVLVLPSVPFPKNKRDVDPLFTVRLVIAAGCPISRDGL
VWTNCPLDSGSEFIRSKFHKHLIRTSFHQDAYVDLNVFVPGSYCYYVSFKGDKDKLDTTR
KFYFIVPPALYIGDRYLPMGSLSVQTLVSKWIDKNDWSAMFSKVAEKGYNMIHFTPLQKR
GKSDSPYSLFDQLQFDPTFFQDKNDVIQMVNKLHKEYGILTMTDVVFNHTASDSLWLLDH
PEAAYNMETAPQLISAMELDHELIKFSDNMEELGYPIIIKSTSDLLHVIDGIKTHVLNHL
KLWEFYVINVQKTLAEVPAKWNATDDVDIEVPEDIKYDLTKLAEYVRTCAAEKNFTSLST
RYSNQLNILKFISILKGLYGTTWGGETQQEAVKILDAVNLPLYKDYDTDVAAILEQLYNR
IRYLRLDPTGPQLGKITKECPLTECYFTRVTAKNGKEYSFANNGWIWNGNPLVDFASSDS
RAYLRREVIIWSDCVKLRYGNGPEDSPYLWERMSKYITLNAEIFDGFRIDNCHSTPLHVG
EYFLDLARKVNPNLYITAELFTGNEALDCLFVERLAISSLIREAMQASSEEELSSIVHRY
GGKPIGSYHYMPLDDFPYSAQLPKDDISLPEFGFIQQNANPEGISYAVPNVLTATSPHAL
FMDCTHDNETPYQRRTLEDTLPTALLVSFCSSAIGSVYGYDEVYPHQLDLVQENRTYSVQ
HGDGISNVRSKLNKIRSLMVANSDSIEDSEMYLHHDWQYITCHKTHAKSPDGWFLIARTK
FFDDGKEQTLPDITLSSIKCKLEFSYSLEKIGDVPAEDDSVIHGIPTRLNKLDGFVVKYD
SEQNVSTISLPEYFPKGSIAVFRTTQLGFDKDLDQFIKSGIVSATENLNLYSLNTILYRC
NAEELDITSGRIGVYYVPNYGELCYCGLQGWVSVLKDVIFRNDLAHPLSEHLRNGHWAMD
YMVDRLNEYAENAGISEIKEWLRLRFERVKLLPYYLIPRYFALVVGVAYAACRCRAMSLM
PKHISCATLFVQRLAMMSIQLVSKVQSASLYPDINVPSMAAGLPHFSTGHMRCWGRDVFI
SLRGLLVITGRVNDAKAHILGFAKTLKHGLIPNLLAAGREPRYNARDATWFFLQSVQDYI
TIVPDGEQILNEKVTRRFPLDDRYIPYDDPECFTHVSSVEDIIYEIFARHARGIKYREAN
AGPDLDRVMKDNGFNVEVTIDWDTGLIHGGSQDNCGTWMDKMGESKKAGTYGVPGTPRNG
AAIEINGLLKSALRFVIDLNERGLFKYKEVVRSDNSKITFKEWNRLLQNNFERFFYIPKD
PSRDSDYEINPILVNRRGIYKDLFGTGKPYEDYQLRPNFAIAMTVAPELFTPEFAMGALE
IADNFIRGPIGMVTLDPSDSDYYPYYVNSEDSYNAHTAKGRNYHQGPEWVWCTGFFLRAY
HHFNVQATSKALVSKRKISSSLYHQLSRRLDGHRNWIAESPWAGLTELTNKDGQFCHDSS
PTQSWSSGCLLDLFYDLWSEYENF
NT seq 4575 nt NT seq  +upstreamnt  +downstreamnt
atgaggagatttttattgagacttggagatggtggtgaacctgtggagagttgttctaac
ggtaaaggggttttggttttgcccagcgttccatttccgaagaacaagagggacgtggat
ccgttgttcactgtgaggttggtgatagctgcagggtgtccaatatcgcgggatggatta
gtgtggactaattgtcctcttgatagtgggagtgagttcattaggagtaagttccataag
catctgatcaggacgagttttcatcaggatgcatatgtggatctgaatgttttcgtccct
ggatcatactgttattacgtatcgtttaagggtgataaagacaagttagatacgactcgg
aagttttattttatagtacctcctgcattatatattggggatcgctatttgcctatgggt
agtctttctgtgcaaacgcttgtgtctaagtggattgataagaatgattggtcggctatg
tttagcaaagttgcagaaaaaggatataatatgattcatttcactcctcttcagaaaagg
gggaaatcagattcaccgtattcgcttttcgatcaattgcagttcgaccccacgtttttt
caggacaagaatgatgtaatacagatggtgaacaagttgcacaaggagtatggaatttta
accatgactgatgttgtttttaaccacactgctagcgattccctctggctgctggaccac
cctgaagcggcgtataacatggagactgctccacaattgatctctgccatggaactggat
catgaattgataaagttcagtgataacatggaggaattaggctaccctataattataaaa
tcaacaagtgatttgttgcatgtaattgatggaatcaaaacccatgtattaaatcatcta
aaattgtgggagttctatgttattaatgtgcaaaagacgttggctgaagtgcctgccaaa
tggaatgcaactgatgatgtagatattgaagtccctgaggatataaaatatgaccttacc
aagcttgccgagtatgttcgcacgtgtgcagcagaaaagaattttacttcattaagcact
agatattccaatcagctcaatatcctcaagtttattagcattttaaagggtttgtatgga
accacatggggaggagagacacagcaggaggcggtcaaaatcttggatgcagttaattta
ccgctctataaagattatgatacggatgtagcagcaattttggagcagctatataataga
atccgttatttaagacttgacccaaccggcccgcagctcggaaaaataaccaaggaatgt
cccctcactgaatgctatttcacaagggtcactgcaaaaaacggaaaggaatattccttt
gcaaacaatggttggatatggaatggtaatccgttggtcgattttgcctcaagtgactct
agagcatacttacgaagagaagtcattatttggagcgattgtgttaagttgagatatgga
aatggccccgaagactctccgtatttatgggagaggatgtcaaagtatatcactttgaat
gcagaaatatttgacggcttcagaattgataattgccattcgacacctttgcatgtcggt
gaatactttttggatctagcaaggaaagtaaatccaaacttgtatattacggcagaactt
tttaccgggaatgaggcgcttgactgcttgtttgtggaaagattggctatctcatccttg
attagggaggccatgcaagcttcgtctgaagaggagttatcaagtattgttcacagatat
ggtggtaagcccattggttcttaccactacatgcctctggatgacttcccctattcggct
caactacccaaagatgatatttccctccctgaatttggttttattcagcagaatgccaac
ccagaaggtatttcatatgcggttccaaacgttttaactgctacttcgccacatgcattg
tttatggattgcacgcatgataatgaaacgccataccagagaagaactttggaagacacg
ctaccaacagctctattggtttcattctgttcttcagctatcggttcagtatatggatat
gatgaggtttatcctcatcaactagatttggtacaagagaacagaacgtattccgttcag
catggtgatggcatatcgaatgtaagatccaagttgaataaaattagatctttgatggtt
gctaacagcgatagtatcgaggactctgagatgtatctacatcacgattggcagtatatc
acctgtcacaaaacccatgcaaaaagtccggacgggtggttcttgattgcgagaacaaaa
tttttcgatgatggtaaggagcaaactttacctgacataactttatccagtataaagtgt
aagttggaattcagttactcattggaaaagattggtgatgtacctgctgaagatgatagc
gtcatacatggtattcctacgcgactaaacaaactcgatggttttgtggttaaatacgac
tctgaacaaaatgtctcgactatcagtttaccagaatatttccctaaagggtcgatagcc
gtgtttaggactacccaactcggttttgataaagatctggatcaattcattaaatccggc
attgtctcagctaccgaaaatttaaatttgtacagtttaaacacaatcctttacagatgc
aacgcagaagagctagatatcacatctggacgcattggcgtatattatgttccaaattat
ggagaactgtgctattgtggtttacaaggatgggtttctgtcctgaaggatgtgatattt
cgtaacgatttagctcatccactaagtgaacaccttcgaaacggtcattgggcaatggat
tacatggtggatagattaaacgaatatgctgaaaatgcaggtatttctgaaatcaaagaa
tggttaagattgcgttttgaaagggtgaaacttttgccttattacttaattcctagatac
tttgccttagttgtaggtgtcgcatacgctgcgtgccgttgcagggcaatgtcattgatg
cccaagcacattagctgcgccactttatttgtacaaagattggcaatgatgtcgattcaa
ctggtttctaaagttcagtctgcttcattatatcctgacataaacgttccctcaatggca
gcaggattgcctcatttttccaccggacatatgagatgttggggtagagatgtctttatt
tcattgagaggccttttggttattacaggtagagtaaatgatgctaaagcgcatattcta
ggctttgcaaaaacgttgaagcatggtttgattccaaaccttctcgcagctggcagagaa
ccaagatacaatgcgcgcgacgccacatggtttttcttacagtctgtccaggattatatc
acaattgttccggatggcgaacaaatattgaatgaaaaggtcactagaaggtttccatta
gatgacagatatattccttatgatgacccagagtgcttcacacacgtatcctcggttgaa
gacataatctatgaaatttttgcgaggcatgcaaggggtataaagtatcgtgaagcaaat
gccggtccagatttagacagagttatgaaggacaatggtttcaacgtggaagtaactatt
gactgggacactggtcttatccatggagggtctcaagacaattgtggaacctggatggat
aaaatgggtgagagcaagaaggcaggcacttacggagttcctggcacaccaagaaatgga
gcagctattgaaataaatggattgttgaagagcgcactaagattcgtcatagatttaaat
gaacgtgggttgttcaaatacaaagaggtagtccgatcagataattctaagattacattc
aaagaatggaacagactattgcaaaacaactttgagaggtttttttacataccgaaggat
ccttccagagattccgactacgaaataaatcctatccttgttaatagacgtggtatatac
aaagatttgtttgggaccggtaaaccatatgaagattatcaactacgccctaattttgcc
attgcaatgaccgttgcaccagaactcttcactccagaatttgcaatgggtgccctagaa
atagcggacaacttcattagaggccccattggtatggtaaccctcgaccccagtgactcc
gattattatccatattacgtaaacagcgaagactcatataacgcacacacggcaaagggc
agaaactaccaccaaggtcctgaatgggtctggtgcaccggttttttcttacgggcttac
catcacttcaacgtccaagcaacctcaaaggcactagtatcaaagagaaaaatctcttct
tctctctatcatcagttgtcacgcagattggacggtcaccgtaactggatagctgaaagc
ccctgggcaggtctaacagaactcaccaacaaagatggccagttctgtcacgattctagc
ccaacacagtcttggtccagcggctgcctactggatcttttctacgacttgtggagtgaa
tatgaaaatttttga

DBGET integrated database retrieval system