KEGG   Eremothecium cymbalariae: Ecym_3005Help
Entry
Ecym_3005         CDS       T02237                                 

Definition
(RefSeq) Hypothetical protein
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00562  Inositol phosphate metabolism
erc01100  Metabolic pathways
erc04070  Phosphatidylinositol signaling system
erc04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Ecym_3005
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Ecym_3005
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Ecym_3005
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Ecym_3005
Membrane trafficking [BR:erc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    Ecym_3005
 Endocytosis
  Macropinocytosis
   Phospholipase C
    Ecym_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_1 EF-hand_10 C2 EF-hand_6 EF-hand_7 DUF1473 EF-hand_5 G6B
Motif
Other DBs
NCBI-GeneID: 11468612
NCBI-ProteinID: XP_003645341
UniProt: G8JQV5
Position
3:complement(9078..11699)
Genome map
AA seq 873 aa AA seqDB search
MKVEDLPLLDIRGQNMDDEQRSNVFVRKSRTPVGVLSHMEDQHHITSVSSYESSSYEPIS
SGVKGIIRKTMALVSGVKVNYKREGDVGPLTYAQSYRSNKDSSACDTANEDALVPTSPNR
LFPMGSIIEMDLTKVSRKKRVQYKFVIKDGFIVWKNKKSLELDMIQDIRVGESAANYREG
YGISDSFAERWITIIYLDFPNKLKTLHLIARTVKECTKFYMIVKGLVRQRQELMESISVP
SNEQFANIHWQANVSAKKEDEDKDTLSLDDVKNLCHKFHIYCSPTYLERFFKLADINRNG
LLNLKEFQLFIKLLTRRNDITEIWRDISKPGSVLDFEKFYNFLIDIQGESISRHLTEKIF
EKYSIDGIMDEDLLLKFLSSQRYLKEVKEDYTRPLNEYFISSSHNTYILGNQVGGMASVE
GYIQALQKGCRSLEIDIWDGDDGPVVCHGKLTSSIPLRNVIEVIRKYAFITSPYPLVLSL
EIHCRSEGQFLIARLFEELLGSLLYMGNSFGALPSPMELKHKILLKSKKPKWNLDTVTSD
SPSHSASSKSSCESEYDTSFSSSPYWKRRQPIPGISFTKKKVCVIDAILKLSAVHGIQFR
NFSLPESKTPTHCFSLSERKFDNLCKDENQRLAIDKHNRRHLMRTYPHALRYKSSNFDPI
KCWKVGVQMVATNWQTYDLGQQVNQAMFGSFDHKEFPWHPGYVRKPDYLLKQVSKTKDLL
KIYESATSKISITIDIISAQLLPKLKSINKDTGITFAPFVVTDIIGDGLIGSIKVNQNGH
TATFTQGLTKPCKDVGFNPVWKTTITAVLQNTSFNFIRFTVKNGDLNLGTCCIRLNYLKK
GYRNIPLYSMTGEKFIFSTLFIKYNYSITEPNI
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaagacttgcctcttttagatataagagggcaaaatatggatgatgagcaa
cgctcgaatgtatttgtgcggaaaagtagaactccagtaggggttctttcgcatatggag
gaccaacatcacatcacctcagtttccagttacgagagttcatcatatgaaccgatttcg
agtggcgttaaaggtataataagaaagactatggctcttgtttcaggagtcaaggtaaat
tataagcgggagggcgatgtaggaccgttgacctatgcgcaatcatatcggtcaaataaa
gacagcagtgcttgtgatactgcaaatgaggatgcattagttccgacaagcccaaatcgg
ttgtttcccatgggttcaataatagaaatggatctaacgaaagtttcaaggaaaaaaaga
gtgcaatacaagtttgtcatcaaggatgggtttattgtgtggaaaaacaagaaaagctta
gagttggatatgatacaggatattcgtgtaggagaatcggcagccaattatcgagagggt
tatggtatttcagactcgttcgcagaaagatggataacaataatctacttagattttcca
aataagctgaaaacgttgcatttgattgctcggacagtaaaggaatgcactaagttttac
atgattgtaaagggtctagtgaggcagagacaggagctgatggaaagtatatctgtgcca
agtaatgagcagtttgcaaatattcattggcaggcaaacgtctctgccaaaaaagaggac
gaagacaaagatacgctatcattagatgatgtgaagaatttatgccacaagtttcatata
tattgttctccaacatatttagaacggttttttaaacttgcagacattaatcgcaatggt
ttattgaatttgaaagaatttcagctattcatcaaattattaacaagacgaaatgacatt
actgaaatatggcgtgacatatctaagcctgggagtgtgcttgactttgaaaaattctac
aattttttgatcgacatacaaggggagtctattagcagacatttgacagaaaaaatcttt
gagaagtactcaattgatggtataatggatgaagatttacttctaaaatttctatcctct
cagcgatatcttaaggaagtcaaggaggattacacaagacccctaaatgaatattttata
tcttcgtcccataacacttatattttaggaaatcaggttgggggtatggctagtgttgaa
ggatacattcaggcactacaaaaaggttgtcgttctttggaaatagatatatgggatgga
gatgacggtcccgtggtatgccatggtaagttaacatcatccattcctctaagaaacgtt
attgaggtaatcagaaagtatgcttttattacctccccatatcctttagttctttctttg
gaaatccactgtcgctctgaaggtcagttcctaatagctaggctgtttgaagaactattg
ggatcactattatatatgggcaattcctttggtgcattacctagccccatggagttaaaa
cataaaatccttctcaaaagcaaaaagccgaaatggaacttagatacagtaacttcggac
agtccaagtcattcagcatcctctaaaagttcatgtgaatctgaatatgacacatcattt
agttcaagtccttactggaaaaggagacagcccataccgggcataagcttcaccaaaaag
aaagtttgcgtgatagatgcaattttaaaactttcagcagttcatggaatacaatttcgc
aacttttctctcccagaatctaaaaccccaactcattgtttttctttgagcgagagaaag
tttgataatctttgcaaagatgagaaccaaagattagcaattgataaacataaccgacgg
catttaatgaggacttatcctcatgcacttcgatacaaatcatctaattttgatcctata
aaatgctggaaagttggtgtccaaatggtagcaactaattggcaaacttatgaccttgga
cagcaagtaaatcaagcaatgtttggaagttttgaccataaagagtttccgtggcaccca
ggatatgtccgcaaaccggattatttactaaagcaagtttcaaagactaaggacctttta
aaaatatatgaatccgcgacttccaaaattagtattacaatagatataatatccgcacaa
ttattaccaaaattaaaaagcatcaacaaggataccgggattacatttgcacctttcgtc
gttacagacataatcggcgatggtctaatagggtctataaaagtgaaccaaaatggccat
actgcaacatttacacaaggcttgaccaagccatgcaaggatgttgggtttaatcctgta
tggaaaacaactataaccgcggtcctccagaatacaagcttcaattttatcagatttact
gttaaaaatggtgatctaaaccttggtacatgttgcataagattaaattacttaaagaag
ggctacaggaatatccccctatacagtatgacaggagaaaagttcatattttctaccctt
ttcatcaaatacaactatagcattactgagccaaatatataa

DBGET integrated database retrieval system