KEGG   Eremothecium cymbalariae: Ecym_3005Help
Entry
Ecym_3005         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
erc  Eremothecium cymbalariae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Ecym_3005
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Ecym_3005
Enzymes [BR:erc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Ecym_3005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(9078..11699)
Genome map
AA seq 873 aa AA seqDB search
MKVEDLPLLDIRGQNMDDEQRSNVFVRKSRTPVGVLSHMEDQHHITSVSSYESSSYEPIS
SGVKGIIRKTMALVSGVKVNYKREGDVGPLTYAQSYRSNKDSSACDTANEDALVPTSPNR
LFPMGSIIEMDLTKVSRKKRVQYKFVIKDGFIVWKNKKSLELDMIQDIRVGESAANYREG
YGISDSFAERWITIIYLDFPNKLKTLHLIARTVKECTKFYMIVKGLVRQRQELMESISVP
SNEQFANIHWQANVSAKKEDEDKDTLSLDDVKNLCHKFHIYCSPTYLERFFKLADINRNG
LLNLKEFQLFIKLLTRRNDITEIWRDISKPGSVLDFEKFYNFLIDIQGESISRHLTEKIF
EKYSIDGIMDEDLLLKFLSSQRYLKEVKEDYTRPLNEYFISSSHNTYILGNQVGGMASVE
GYIQALQKGCRSLEIDIWDGDDGPVVCHGKLTSSIPLRNVIEVIRKYAFITSPYPLVLSL
EIHCRSEGQFLIARLFEELLGSLLYMGNSFGALPSPMELKHKILLKSKKPKWNLDTVTSD
SPSHSASSKSSCESEYDTSFSSSPYWKRRQPIPGISFTKKKVCVIDAILKLSAVHGIQFR
NFSLPESKTPTHCFSLSERKFDNLCKDENQRLAIDKHNRRHLMRTYPHALRYKSSNFDPI
KCWKVGVQMVATNWQTYDLGQQVNQAMFGSFDHKEFPWHPGYVRKPDYLLKQVSKTKDLL
KIYESATSKISITIDIISAQLLPKLKSINKDTGITFAPFVVTDIIGDGLIGSIKVNQNGH
TATFTQGLTKPCKDVGFNPVWKTTITAVLQNTSFNFIRFTVKNGDLNLGTCCIRLNYLKK
GYRNIPLYSMTGEKFIFSTLFIKYNYSITEPNI
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggaagacttgcctcttttagatataagagggcaaaatatggatgatgagcaa
cgctcgaatgtatttgtgcggaaaagtagaactccagtaggggttctttcgcatatggag
gaccaacatcacatcacctcagtttccagttacgagagttcatcatatgaaccgatttcg
agtggcgttaaaggtataataagaaagactatggctcttgtttcaggagtcaaggtaaat
tataagcgggagggcgatgtaggaccgttgacctatgcgcaatcatatcggtcaaataaa
gacagcagtgcttgtgatactgcaaatgaggatgcattagttccgacaagcccaaatcgg
ttgtttcccatgggttcaataatagaaatggatctaacgaaagtttcaaggaaaaaaaga
gtgcaatacaagtttgtcatcaaggatgggtttattgtgtggaaaaacaagaaaagctta
gagttggatatgatacaggatattcgtgtaggagaatcggcagccaattatcgagagggt
tatggtatttcagactcgttcgcagaaagatggataacaataatctacttagattttcca
aataagctgaaaacgttgcatttgattgctcggacagtaaaggaatgcactaagttttac
atgattgtaaagggtctagtgaggcagagacaggagctgatggaaagtatatctgtgcca
agtaatgagcagtttgcaaatattcattggcaggcaaacgtctctgccaaaaaagaggac
gaagacaaagatacgctatcattagatgatgtgaagaatttatgccacaagtttcatata
tattgttctccaacatatttagaacggttttttaaacttgcagacattaatcgcaatggt
ttattgaatttgaaagaatttcagctattcatcaaattattaacaagacgaaatgacatt
actgaaatatggcgtgacatatctaagcctgggagtgtgcttgactttgaaaaattctac
aattttttgatcgacatacaaggggagtctattagcagacatttgacagaaaaaatcttt
gagaagtactcaattgatggtataatggatgaagatttacttctaaaatttctatcctct
cagcgatatcttaaggaagtcaaggaggattacacaagacccctaaatgaatattttata
tcttcgtcccataacacttatattttaggaaatcaggttgggggtatggctagtgttgaa
ggatacattcaggcactacaaaaaggttgtcgttctttggaaatagatatatgggatgga
gatgacggtcccgtggtatgccatggtaagttaacatcatccattcctctaagaaacgtt
attgaggtaatcagaaagtatgcttttattacctccccatatcctttagttctttctttg
gaaatccactgtcgctctgaaggtcagttcctaatagctaggctgtttgaagaactattg
ggatcactattatatatgggcaattcctttggtgcattacctagccccatggagttaaaa
cataaaatccttctcaaaagcaaaaagccgaaatggaacttagatacagtaacttcggac
agtccaagtcattcagcatcctctaaaagttcatgtgaatctgaatatgacacatcattt
agttcaagtccttactggaaaaggagacagcccataccgggcataagcttcaccaaaaag
aaagtttgcgtgatagatgcaattttaaaactttcagcagttcatggaatacaatttcgc
aacttttctctcccagaatctaaaaccccaactcattgtttttctttgagcgagagaaag
tttgataatctttgcaaagatgagaaccaaagattagcaattgataaacataaccgacgg
catttaatgaggacttatcctcatgcacttcgatacaaatcatctaattttgatcctata
aaatgctggaaagttggtgtccaaatggtagcaactaattggcaaacttatgaccttgga
cagcaagtaaatcaagcaatgtttggaagttttgaccataaagagtttccgtggcaccca
ggatatgtccgcaaaccggattatttactaaagcaagtttcaaagactaaggacctttta
aaaatatatgaatccgcgacttccaaaattagtattacaatagatataatatccgcacaa
ttattaccaaaattaaaaagcatcaacaaggataccgggattacatttgcacctttcgtc
gttacagacataatcggcgatggtctaatagggtctataaaagtgaaccaaaatggccat
actgcaacatttacacaaggcttgaccaagccatgcaaggatgttgggtttaatcctgta
tggaaaacaactataaccgcggtcctccagaatacaagcttcaattttatcagatttact
gttaaaaatggtgatctaaaccttggtacatgttgcataagattaaattacttaaagaag
ggctacaggaatatccccctatacagtatgacaggagaaaagttcatattttctaccctt
ttcatcaaatacaactatagcattactgagccaaatatataa

DBGET integrated database retrieval system