KEGG   Eremothecium cymbalariae: Ecym_3138Help
Entry
Ecym_3138         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
erc  Eremothecium cymbalariae
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ecym_3138
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     Ecym_3138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(255001..256767)
Genome map
AA seq 588 aa AA seqDB search
MLMLSRFSRSYSRALLEESGIVIKDQGPKAPQHSQDGIIQNDSDSQTSSALETASLISCV
TCLSDNTDSRGGNSLLLPPNTVIPYSKILDVRLVPRDSASSGKNDVYDKYPDSDASRPVD
DCDKVHHEMSIDAFYRKAYHPEPDQGILVEVVFARPRRNDLVPKTVTLLIDRSSGLLCNE
ENVDVVEKILERSYKNTKRNKSILVIINPHGGRGRANKIYVTKAKPILIASGCYVEVFQT
SYPEHAIEIARTMDIDKYDVIACASGDGIPYEVLNGLYRREDRAKAFNKVAVTQLPCGSG
NAMSVSCHGTNNPAYAALSLVKAVEVRMDVMCCSQPSYLDGPRLSFLSQTYGVIAESDIN
TEFLRWIGPARFELGVTLNIFQRRKYPCEIYVKYAAKSKNELKDYYLLHKARIKQSTLKL
DFDFSNTDSGSSDGSCSGDSIDETLFEPKWSLDDPVPSDWEMIDQDLADNIGIFYVGKMP
YVAADTKFFPAALPDDGSMDMVITDARTPLTRMAPILLSLDKGSHVLQPEVEHSKIFAYR
LVPKLKNSVISVDGEKFPYETLQVEVLPRLVKMLLKNGNYVETEFNIL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgttaatgttaagtcgatttagcaggtcatattccagagcgcttctcgaagagagcggt
atcgttatcaaggatcagggacctaaggcacctcaacattcacaagacgggattattcag
aatgacagcgatagccaaactagcagtgctcttgaaacggcgtctttaatcagttgtgtt
acttgcttaagtgataacacagattcgcgaggcgggaactcattgttgttacctcctaat
actgttattccatatagcaagattttagacgttagattggtacctagagacagcgcgtct
tctggtaagaatgatgtatatgataaatatccagattctgatgcctctagaccggtcgac
gattgtgacaaagttcatcatgagatgagtatagatgcattctacagaaaagcgtatcat
ccggagccggaccaaggtatacttgtggaagtggtatttgctagacccaggcggaacgac
cttgttcctaaaacagttactttgttaattgatagatcatctgggttgctttgcaatgaa
gaaaatgtggatgttgttgagaagattttggagcgaagctacaaaaataccaaacgtaac
aaatccattcttgtaataatcaatccgcatgggggtcgaggtagggccaacaaaatatac
gttacaaaggcgaaacccatacttatagctagtggatgttatgttgaagtgtttcagact
tcgtacccggaacacgccattgagatagccaggacaatggatatcgataagtatgacgta
atagcttgtgcatctggtgatggcattccatatgaggtgttaaatggcttgtacagacgt
gaagatcgtgcaaaggcgtttaataaggtggcggtaactcagttgccgtgcggctcaggg
aacgcaatgagcgtttcatgccacgggacgaacaatccggcatatgctgcgctatcgtta
gtcaaggcagttgaagttcgaatggatgtgatgtgctgctctcagccgtcgtatttagat
ggccctcggctttcattcctttctcagacttatggagttatcgccgagtcagacatcaat
acggaattcttgaggtggattggtccagcaaggtttgaactgggtgtgacattgaatatt
ttccaacgcaggaaatacccttgcgagatatatgtaaaatatgctgctaagtcaaaaaac
gaattaaaggattattatttgttacacaaggctcgcattaagcaaagcactctgaaatta
gattttgacttttcaaacacagattccggttcttctgatggatcatgctccggagattct
atagatgaaacgctatttgagcctaagtggtctttggatgatcctgtaccatcggattgg
gagatgattgaccaagatctagctgataatataggtatattctacgttggtaaaatgcca
tacgttgcagctgatactaaatttttccctgctgcattaccggatgatggaagtatggat
atggtgattactgacgcaagaacgccgttaaccagaatggcaccaatattactatcgtta
gacaaaggatcccatgtcttgcaacccgaagttgaacattccaaaattttcgcctaccgc
ttggtgcccaagttaaagaatagcgtaatatcggtagatggtgagaagtttccctacgag
actttacaagttgaagtattgccaagattagtgaagatgttgttgaaaaatggcaactat
gtagaaacagaattcaacatattatga

DBGET integrated database retrieval system