KEGG   Eremothecium cymbalariae: Ecym_3152Help
Entry
Ecym_3152         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
erc  Eremothecium cymbalariae
Brite
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   Ecym_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(280175..287557)
Genome map
AA seq 2460 aa AA seqDB search
MLKRKGDKSKKRLTSITTSTDDLFVESASAAGTAGASSAAVGNGTSGDITKSAATQGSVE
GESDISFTGFTVIFNRLKSNNSQERKAASFELKNSLISLAREVSTEHFQRFSNELNNKIF
ELIHGSDSNEKLGGVLAVNTLIDFYSHTDELPNQTSRLANYLRVLIPSSDIDVMRSAATT
LGKLAVPGGTLTSDFVEFEVKTCIEWLTTSPESSSSNSKQEYRKHASLLIITAIANNSPY
LLYPYLNSILDNIWRALRDTKLVIRTDAAITLSHCLAIINDRDSILTNRWVQRLFKGCTY
GLNLSTNEAVHGTLLVYRELVSLKGPYLHEKFNEIYDTTMRYKDHKSAVIRKELYAILPL
LASFDPRLFTETYLDNTMVHYLTLLKNMHSNLINNPDKAAILVSIGDIAYEVRSSIAPYM
DSILDNTRDGFMTKYKVRKHFESELFYCIAKLACAVGPAISKYLHSDLLDLMLACPLSDH
MQDTLETLNEEIPALEALINEKLLDLICYSLSGDKFRPPGSPTPVKQFSADRARNYRDQS
WLRKTNDINDNNQDAIILTQALRMLTTINHKYSLTELVRYVTISYIEHENPQVRKLAALT
SCDLFVKEHICKQSSLHALNAVAEVLSKLLTVAITDPVAEIRFEILKHLDSSFDPQLSQP
DNARLLFMALNDEVFAIQMEAMKIVGRLSSVNPAYIVPSLRKTLIQLLTELKHSSMTRKK
EESASMFCTLISSSKDVTRPYIEPILDVLLPKCQDNSSAVASTALKAVGELAVVGGESMK
DYLDKLMPLIINNFQDQSNSFKRGAALKTLGQLASSSGYVINPLLDYPQLLGILVKILKA
ESSQGIRRETVRLIGILGALDPYKHREVERTSSTQISVEQNAPSIDVALLMQGMSPSNEE
YYPTVVINTLMKILKDHSLSSHHTAVIQAVMHIFQTLGLRCVSFLKQIIPGMINVMRTCP
PSILEFYFQQLGVMVAIVKQHIRPYVDEIFEVIKEFFPFIKLQITIISVIESISKSLEGE
FKPYIPTTLTLFLDVLEKDNSNKKIVSIRILKSLVVFGSNLDDYVHLVIPSIVRMCEYSS
GNLNKAAIVTIGRLAKNVNLSEMSSRIVQTMIRVLSTSDQQLIRATMNTLSLLLLQLNTD
FTVFVPIINKTLVKGHIQHSIYDQLVGKLLNNEPLPTKIVVDKDFDVSNKEITESEVLSR
KLPVNQTVLKSAWDCSQQRTKEDWQEWIRRLSIQLLKESPSHALRACSGLAGIYYPLARE
LFNASFASCWTELYTQYQEDLVKSLCSALSSPNNPPEIHQTLLNLVEFLEHDDKSLPISI
PTLGEYAQRCHAYAKALHYKELEFIQEPSTSTIESLISINNQLHQTDAAIGILKHAQQHH
DLQLKETWYEKLQRWDDALNAYNQREAAGEDTIEVTMGKMRSLHALGEWEQLSELAADKW
MTSKLEIKRIIAPLAAGAAWGLAQWDSIEKYINVMKPQSPDKEFFDAILCLHRNNFEKAA
EHIFLARDLLVTEMSALVNESYNRAYSVVVRSQMIAELEEIIQYKKLPQISEKRIMMRKT
WNHRLLGCQKNVDVWQRILRVRSLVVKPKQDMQVWIKFANLCRKSGRMGLAQKALNSLLE
EGGDPEHPNTARAPPPVVYAQLKYIWATGSRKDALRHLISFTSRMAHDLGLDPSNMIAQS
VSKNSIVPPNHTEEYTKLLARCFLKQGEWRVMLQPNWRTETPDAILGSYLLATHFDNIWY
KAWHNWALANFEVISLMTDRVREEQRAQKSNNDTQLQVNGGTQHTTFVLEASNVNGVDYH
PELVQRHVVPAIKGFFHSISLSESNSLQDTLRLLTLWFTFGGIPEAAQAMHEGFNLIKID
NWLEVIPQLISRIHQPNQTVSRSLLSLLSDLGKAHPQALVFPLTVAIKSESVSRQRAALS
IVEKMRMHSSNLVEQAELVSDELIRIAVLWHELWYEGLEDASRQFFGEHNTEKMFATLEP
LHEMLKRGPETLREISFQNSFGRDLNDAYEWVMNYKRTQDISNLNQAWDIYYNVFRRISR
QLPQLQTLDLQHVSPKLLAAHNLELTVPGTYHTGRSIVRIAHFEPVFSVISSKQRPRRLS
IKGSDGKDYQYALKGHEDIRQDSLVMQLFGLVNTLLQNDPECFRRHLDIQKYPAIPLSPK
SGLLGWVPNSDTFHVLIREYRESRKIQLNLEHRIMLQMAPDYDNLTLLQKVEVFTYALDN
TKGQDLYKVLWLKSRSSESWLERRTTYTRSLAVMSMVGYILGLGDRHPSNLMLDRITGKV
VHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENVMKVLRDNKES
LMAILEAFAHDPLINWGFDLPTQAITEQTGIQLPLTNPSELLRNGVITVEEAARMEVQQR
VEIRNARATLVLKRITDKLTGNDFRSSHELNVPEQVDKLIQQATSVENLCQHYIGWCSFW
NT seq 7383 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaagaaaaggagacaagtccaagaagcggttaacttcgataactacctctact
gatgatttattcgttgaatctgcttctgctgctggcacagcaggtgcctcttctgcagca
gtcggcaatggaacctccggggatataacaaaatcagccgctactcaagggagtgttgag
ggggaatctgatattagctttactgggtttactgtgattttcaatagattgaaaagtaat
aatagccaggaacgcaaagcagcctcatttgagttaaaaaatagtttgatctctttggca
agggaggtgtctacagagcatttccagaggttcagtaatgaattgaataacaagattttt
gaattgatacatggctcggattcgaatgaaaagttaggtggtgtactagcggttaatacg
cttatagacttttattctcatacggatgaactgcctaatcagacatcccgattagcgaat
tatttgcgggttttaataccttcaagtgatattgatgttatgcggtctgcagcaacgacg
ctgggtaaattagccgttcctggtggtacacttacttccgactttgttgaatttgaggtg
aaaacttgtattgaatggttaacaacatccccggaaagttcttcttccaactcaaagcaa
gaatacaggaagcatgcatcattgttaattattacggcaatcgcgaataattctccgtac
ctcctgtatccttatttgaactccatattggataatatttggagggccttgagagatacg
aagctggtaattagaactgacgctgcaattacattaagtcattgtttggctattattaat
gatcgagactctatattaaccaatagatgggttcagagattatttaaaggctgtacatat
gggctgaatttgagtacaaatgaggctgttcacggcactcttctcgtttaccgagagcta
gtatctctaaaggggccttatttgcatgagaagttcaatgaaatctatgatacaaccatg
aggtataaggatcataaatctgctgttattaggaaggaattgtatgcaatcctgcctctc
cttgcctcatttgacccaagattgtttaccgaaacctacttggacaacactatggtgcat
tacttgactcttcttaagaacatgcactctaacctaataaacaatccggataaagccgcc
atactcgtttcaattggagatattgcctatgaagtccgctcgagtattgctccatatatg
gattcaattttagacaatactagagatggtttcatgacgaaatataaagtccgcaaacac
ttcgagagtgaattattttattgcattgcaaaattagcatgtgccgttggtcctgcaatt
tctaagtacttgcacagcgacttactggacctgatgctcgcttgccctttaagtgaccac
atgcaagataccctggaaacattaaatgaagagattcctgcattagaagccttaataaat
gagaaattacttgatttgatatgttattccttatcgggagacaaatttaggcctccaggt
tcaccaaccccagtcaaacaattttcggctgacagggccaggaactacagagatcaatcc
tggttacgtaagacgaacgatattaatgataataaccaagacgctatcatactaacgcaa
gctttacggatgttaactacaataaatcacaaatattctttaactgagttggttagatat
gtgaccatttcttacatcgaacatgaaaacccacaagttagaaaattggctgccttaacg
tcttgtgatttatttgtgaaagagcatatttgtaagcaatcttctttgcatgcattgaac
gcagtggctgaggtactcagtaaattgttgactgttgctataactgatcctgttgcagaa
atccggtttgaaattttgaaacacttggacagcagcttcgatccccagttatcccagcct
gacaatgccaggttactatttatggcgttgaatgacgaggtgtttgcaattcaaatggaa
gcaatgaaaattgttggtaggttatcatcggtgaatcctgcatatattgttccatcgttg
agaaaaaccctaattcaacttttaacagaattgaaacactcaagcatgaccagaaaaaaa
gaagaaagtgcatctatgttttgtactttgatcagttctagcaaggatgttacgcggcct
tacattgaaccgatattagatgtattgttaccaaaatgccaggataattcgtctgctgtt
gcatctactgcgttaaaggcagtgggtgaactagctgttgtaggaggtgagagtatgaaa
gattacttggacaaattgatgcctttgataataaataattttcaggatcagtcgaattca
tttaaacggggagctgctctgaaaactctgggacagttagcttcatcttcaggttatgtt
attaatccactactcgactaccctcaacttcttggcatccttgttaagattttgaaggca
gaaagttctcaaggtattcgaagagaaactgttagattaattggtattctcggtgctcta
gatccatataaacatcgagaagtagagagaacatcaagcactcagatctctgtcgaacaa
aacgcaccttctatagatgtggctttgttaatgcaaggcatgtccccttctaacgaagaa
tactatcccacagtggtgattaacacattgatgaaaattcttaaagaccattctttgtcc
tcccatcacactgctgttattcaagcggtaatgcatatttttcaaactttaggtcttcgt
tgtgtttcatttctcaaacagataattccaggtatgattaatgttatgagaacttgtcca
ccttcgatattggagttttactttcagcaactaggagttatggttgcaatagttaagcaa
catatacgaccttatgttgatgaaatttttgaagtcatcaaggaattcttcccatttata
aaattgcaaatcaccataatatctgtgattgaatccatatcaaaatctcttgagggagaa
tttaagccttatattccgacgactttgacgttgtttttggatgttctagagaaagataat
tctaataagaaaatagtatctattagaattctaaaatcacttgttgtttttggatctaat
ttggatgattacgtgcacttggttatcccatctattgtcaggatgtgtgaatatagtagc
ggaaatctgaataaggccgctattgtaacaataggaaggttggccaaaaatgtcaacttg
tctgaaatgtcttcaagaattgttcagactatgattcgtgtcctcagtacctcggatcag
caattgatcagggctactatgaataccttaagtttactgttattacaattgaacaccgat
tttacagtttttgtgccaataattaacaaaactttggttaaagggcatattcagcacagt
atatatgaccaattggtaggaaaattattaaacaatgaacctctcccaactaaaatagta
gtggacaaggattttgatgtatcaaataaggaaatcaccgaatcagaagtcctgtcaaga
aaactgccggtaaatcaaacagtgctgaagagtgcctgggattgtagtcaacaacgtaca
aaggaagattggcaagaatggattagaagactttctattcaactgttaaaagagtcccct
tcgcatgctctaagagcatgttctggtttggcgggtatttattatccattagctagggag
ttattcaatgcttcttttgcaagttgttggactgaattatatacacaatatcaggaggat
cttgttaagtctctatgttctgctctttcttccccgaataatccccctgaaatacatcaa
acactgttgaatttggtggaatttttagaacatgatgataagtctttgcccatatctatt
cctacattgggggagtatgctcagcggtgtcatgcatatgcaaaggctctacactataaa
gaactagaatttattcaggaacccagcacttctacaattgaatcattgatcagtataaac
aaccaattgcatcagacagatgccgcaattggtatattgaaacatgctcagcagcatcac
gatttacaactaaaagaaacatggtatgaaaagctgcaaagatgggatgatgctttgaac
gcttataatcaaagagaagctgcaggtgaggataccattgaagttactatgggaaagatg
aggtctctacacgctcttggtgagtgggagcagctgtcagaattggcagctgataaatgg
atgacatctaaacttgaaattaagagaataattgctccattggctgctggtgcagcctgg
ggtttagcccaatgggattcaattgaaaagtacattaatgttatgaaacctcaatcccct
gataaagaattctttgatgcaatattgtgtttgcacaggaataattttgaaaaagcggct
gaacatatttttttggctagagatttactagttacagagatgtcagctttggttaatgaa
agttataacagggcttacagtgttgtagtacgatctcaaatgattgctgagttggaggaa
ataatccaatataagaagttgcctcagatttcagaaaagcgtataatgatgaggaaaaca
tggaatcatagattattaggctgccagaaaaacgttgacgtttggcaaagaattcttagg
gtgaggtcgttggttgtaaaaccaaaacaagacatgcaggtttggattaagtttgctaat
ctatgtcggaagtctggcagaatgggtttggcccaaaaagcgttgaattccttattggaa
gagggtggtgatccagaacatcctaacactgccagagcaccacctcctgttgtttatgct
caattaaaatatatctgggcaactggctcgcggaaagatgctttgcgtcatttaataagt
tttacttctcggatggcacatgatttaggtcttgatccaagtaatatgatagcgcagagt
gtctccaaaaacagcattgtccctccaaatcatactgaagagtacaccaagttgttagcc
cgctgctttttgaaacaaggcgaatggagagtaatgttgcagcctaactggagaactgaa
accccggatgctattttgggctcttatttattggctacacattttgataatatatggtat
aaagcatggcataattgggcattggctaattttgaagtgatatctttgatgacagatagg
gtgagagaagaacagagagcgcagaaaagtaataacgatactcagttgcaggtcaacggt
ggcacgcagcataccacttttgttttggaagcatctaatgttaatggagttgattatcat
ccagaattggttcaacggcatgtagttcctgcaatcaaaggttttttccactctatttca
ttatcagagtccaattctctccaagataccttaaggttgttgactttatggtttaccttt
ggtggtattccagaggcagctcaagcaatgcatgagggatttaatttaatcaagattgat
aattggttggaagtaattccccaattaatctcccgaattcatcaacccaatcaaactgtt
agcaggtcattgttatctttgttgtcagatttgggcaaagcacatcctcaagctctagta
ttccctcttacagtggcgattaagtcggagtctgtatcaaggcaaagagctgcattatca
attgtagagaaaatgcgtatgcacagttcaaatttagtagagcaggcggaattagttagt
gatgaattgattaggattgccgttttatggcacgaattatggtatgagggtctagaagat
gctagcagacaattttttggagaacacaatactgagaaaatgtttgctacattggaacca
cttcacgaaatgttaaaaagaggtccagagacactgcgagagatatctttccagaattcc
tttggaagagatttaaacgatgcctatgagtgggttatgaattacaagcgtactcaagat
atcagcaatttaaaccaagcttgggatatctactacaatgtttttcggcgtatcagtagg
caactaccccaattacagacgttagatttgcaacatgtttcacctaaactgcttgctgct
cacaacctcgaacttacagttcctggcacctatcacaccggaagatcaattgttcgtatt
gctcattttgaacctgtcttttctgtcatttcctcaaaacagagaccacgtcgtttgtcg
attaagggaagtgatggcaaggactaccagtatgcgcttaaggggcatgaagatatcagg
caggatagcttggtgatgcagctatttggcttggtgaacactcttttgcaaaatgatcct
gaatgtttccgcagacatttagatattcaaaaataccctgctattccattatccccaaag
tctggcttattaggctgggtcccaaacagcgacacttttcatgtgttgattagagaatat
cgtgagtcgagaaaaattcagctaaatttggagcatagaataatgctacaaatggcacct
gattatgataatttaacgctgttacaaaaagttgaagttttcacttatgcattagacaat
acaaaaggtcaggatctttataaagttttatggttaaagagtagatcatctgaatcttgg
cttgaaagaagaacgacctataccagatccttggcagtcatgtctatggttggttatatt
ttaggtttaggtgatcgtcatccaagcaatcttatgttggatcgtataacaggaaaagtt
gttcacattgatttcggcgattgttttgaagcagcgattttaagggagaaatatccagaa
aaggttcccttcagattgacaagaatgctgacctatgcgatggaagttagtggaattgag
ggcagtttccgtataacttgtgaaaatgttatgaaggttctgcgggataacaaggaatct
ctgatggcgatcttagaagcatttgcgcatgaccctctgattaattgggggttcgatttg
ccaacccaagcaattacggagcaaactggaattcagctacctttaaccaatccaagcgag
ctcctaagaaacggtgtgattacagtggaagaagcagctcgaatggaggttcaacaaagg
gtggaaattagaaatgctagggcaactctagttcttaaaagaataactgacaagcttact
ggtaatgacttccgcagttcccatgagctgaatgtaccggaacaagtggataaattaatt
cagcaagctacatcagttgaaaacttgtgtcagcattatattggatggtgttccttctgg
taa

DBGET integrated database retrieval system