KEGG   Eremothecium cymbalariae: Ecym_3180Help
Entry
Ecym_3180         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ecym_3180
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Ecym_3180
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Ecym_3180
Lipid biosynthesis proteins [BR:erc01004]
 Desaturase
  First
   Ecym_3180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:344929..346794
Genome map
AA seq 621 aa AA seqDB search
MINDSIPEIDFTNILRDNPHLANRDNAEANELASEGTSKQDSNAEETLEVVESDLNSNPD
QDADVLSNWEQHSDVQSGINDDSFVSDLGIPEFDYGSLLKANPHLQSKVAVDSTKDIPKL
VSTTDNLSSKRNKSQILGSPTAIRGHQRLSKKNREPQIIHLLKKVDLETTTFSIILPIFS
LLRILFAPPEWNWTLVKVWAGYYMLTQLSLHAGYHRFFTHQSYQCHIAVQFVMAILGASC
GLGSILQFSSQHLAHHRYLDTERDPNCLSLYGWWFAQWGHKLFRGNRKSARSIKDCLNTL
ESTSRASYNKEQNATEIVVSASYPLLKWQERNYYQLWILTNILIPSLFAKLICNLSYFSC
IFYLGLFRMSVVQQQWLLIGSLCHLKRFPFASQPFDCSRSAVNLPLGFLAQILTFGESNH
NFHHAFPGDYRNGAAWYGFDPAKWAIQLLAYFGWARNLHTVLNEQMKKSIVQQHQKILDE
ERSKLLWGISFDSLPVMSPEQFSELAQKLYKQDRRALVVIEDIVHDVTPFIHDHPGGVAL
VVCAIGKDATPAFNGAVYAHSTAARNLLATMRIAKLSKDGSSIQRTSWERHLLNDSKGQK
IVRSSNQATYTRINHYAAGAA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgatagcattccggagattgactttacaaacattttaagggataacccccat
ttagcaaatcgagataatgcagaagcaaatgaactggctagcgagggaacctcgaaacaa
gatagtaatgctgaagagacattggaggttgttgaaagtgatttgaattcaaatcctgac
caagatgctgatgtactatcgaattgggaacagcactcagatgttcagtctggtattaat
gacgattcttttgtctcggaccttggcataccggaatttgactatggatcgttgttaaag
gccaatcctcatctacaatctaaagttgctgttgattcaacgaaagacataccaaagttg
gtttcaaccactgataatttatctagtaaaaggaacaagtcgcaaatacttggttctccc
acagctatccggggacatcagagactatcgaagaaaaacagagaacctcagattattcat
ttgttaaaaaaggtggatttagaaactactacattttctatcatcttaccaatattttct
ctgcttcgtatattgtttgctcctcccgagtggaattggacacttgtaaaagtatgggca
gggtattatatgttaacgcaattaagtcttcatgctggatatcaccgatttttcactcat
caatcctaccaatgtcatattgccgttcaatttgtgatggctattctaggtgcatcatgt
ggcttaggttctattcttcaatttagcagtcaacatcttgcgcatcaccgctatttggat
acagaaagagatccaaattgcctatcattatatgggtggtggtttgcacagtggggacat
aagttatttaggggaaataggaaatctgcaagatcaatcaaagattgtcttaacacattg
gaatctacatctcgtgcctcttataacaaagaacaaaatgctacagaaattgtcgtttct
gcaagttatcctttattaaaatggcaagaacgcaactactatcagttatggatattaact
aatatattaataccttctctttttgcgaaactgatatgcaacttgtcttacttcagttgc
attttttatttgggtttattccgcatgtctgtcgttcaacagcaatggttactaataggt
tcattgtgccacttgaaacgattcccttttgcatctcaaccatttgattgttctagatca
gcagttaatttaccattaggatttttagcacaaatacttaccttcggtgaatctaatcac
aattttcatcatgcattcccaggagactatcgtaatggtgcagcatggtatggctttgat
ccagctaagtgggctatacaacttttggcatattttggttgggcacgtaatctgcacact
gtgctaaacgaacagatgaaaaaatcgatagtccaacaacatcagaagattttggacgaa
gaaagatctaaactactgtgggggatctcatttgacagccttccggtaatgagtcctgag
caatttagtgagttggcacaaaagttatacaaacaggatcgaagggcattggttgttatt
gaagacatagttcacgatgtaacaccttttatacatgatcatcctggaggagtagcgttg
gttgtctgtgcaattggtaaagatgcaactcctgcattcaatggtgcagtatatgctcat
tcaactgcagcacgaaatttattagcaactatgcggatcgccaagttgagcaaggatgga
agtagtattcaaagaacttcatgggagaggcatttgctaaatgattccaagggtcagaaa
atcgttcgaagcagcaatcaggctacttatacaagaataaaccattatgcggcaggcgct
gcatga

DBGET integrated database retrieval system