KEGG   Eremothecium cymbalariae: Ecym_3324Help
Entry
Ecym_3324         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(620836..622956)
Genome map
AA seq 706 aa AA seqDB search
MNQESKQKRKLEIDGNDTIGVENMKTAVSKLTVAQQKRPIIVPVVKPKIHYVPLKTGLCY
DVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIEDPTLSGVDDIGNLMLKIP
IREATEDEILLVHSKEHVEFLKTTNTMSREQLLKETEAGDSVYYNNDSLVSAKLSCGGAI
EACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAARNILKNYPESVRKVMIL
DWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPGTEYGNYNQSGEGKGEGFNCNIPWS
CGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFDAADGDTIGQCHVSPACYGHMTHML
KSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEPPDELPDPFKQPKPEAIATIETVIR
EQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQSAVRQEQFRRLSKEYKFVTLPLLD
MELSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWAL
GRSYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGF
VHLLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGN
DSKKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagaatccaaacagaagagaaaattggagatagatggcaatgacacaattggt
gtagaaaacatgaaaacggcagtttccaaacttacggtggcacaacagaaacgtcctatt
attgtacccgttgtgaaaccgaaaattcattacgtccctttgaaaactggattgtgttac
gatgtcagaatgcgataccatgccaaaatattcacatcatattttgaatatattgatcca
catcctgaagatccgaggagaatttatcgtatttacaaaatattagctgagaatggatta
attgaagatccgactttaagtggtgtagatgatatagggaatctgatgttgaagatcccg
ataagagaggctactgaggatgaaatcttacttgttcactcaaaggaacatgtggagttt
cttaaaacaacaaataccatgagtcgcgagcaattgctcaaggagactgaggctggtgat
agtgtttattataacaatgattctttagtaagcgctaaactttcatgtggtggtgccatc
gaagcgtgtaaggcggtggtagaaggccgcgtgaagaatgcattggctgttgtccgccct
cctggccatcatgcagagccggaggtcgccggtggcttctgtctatttagtaacgttgct
gtggctgcacgaaatattttgaaaaactatccagaaagtgtacggaaagttatgatttta
gactgggacatccatcatggcaatggtacccaacgggctttttataacgataaccgcgtg
ttatatgtctctttgcatagatacgagttgggtagatattatcctggtaccgagtatggt
aattataatcaatctggggaagggaaaggggaagggtttaactgtaatatcccatggtcc
tgtggaggcgtaggtgatgctgaatatatgtgggcttttgaacaaatagttattccaatg
ggtcgtgaatttcaaccagatctggtgataatatcatctggatttgacgctgcggatggg
gatacaataggtcagtgtcatgtatcgccagcttgttatggccacatgacacatatgcta
aagtccttggctaagggaaacatgtgtgtcgttttagaagggggctacaatctagattca
atagctaaaagtgctcttggagttgtaaaggtattgataggcgagcctcctgatgaattg
ccagatccttttaagcagccaaaaccggaagctatcgctactatagagactgtaataaga
gagcaagcgaaatattgggattgttttaagagtaaacacggtaattgtggcgttaactgg
aaggaaccggttgatgagtcgttaaccttcaagaacttcccattacagagcgcagttcgc
caagaacagtttagaaggctttcaaaagaatacaagtttgtcacactcccattattggat
atggaactatcaggagataccattatatgttcaccaaatattcatgaaacggatacttta
ataatatgtgtacacgatactcctgaggtatgggcaaagcgtaatcctctaacaggatat
attgatccatctacttccattatagtagatacgacgttgtcaataaccaactgggcttta
ggtagaagttatggcattattgatattaatatcccacaatctttatttgagttggacaat
tattctgctgttcttacgtctcaagaagttttgtcgtatctatgggatcactacttaaaa
ttttttgcacaattaacgagagttgcatttgttgggattggcgatgcttacagtggcttt
gttcatttattaggccacagggacaccagaagtattgtaaaatgtgctatatcttttact
gataagaagcagctaaggcctttagttccattagtagatgaatctataagtgattggtac
ttcaaaaactcattaatattcactagcaaatatcattcctgttggggtactgaaggtaat
gactctaaaaaaccaagaaagaaatttggtagagttttaaagtgtaacagtgatggtatg
aacaatatcttggaggagaggtttgaagaagcaactgatttcattttggattcctttgaa
gagtggagcgattctgaataa

DBGET integrated database retrieval system