KEGG   Eremothecium cymbalariae: Ecym_3334Help
Entry
Ecym_3334         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
erc  Eremothecium cymbalariae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Ecym_3334
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     Ecym_3334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:638201..639364
Genome map
AA seq 387 aa AA seqDB search
MKLSSRLLNYRGFNMSSEVRRRHAEEPIAVSVEHLPRCVAEKSDKTTFKSKGHTLKGPIK
ATRHVVHSKVDLYTFLVTSFALLFISTGYSYRPDFYRKFLSLQYEHSSNPGHYDIGTDDI
YIVFTAVIVLCWIRSFLLEFMLKPFAYYKCNIKSYKSQQRYGEQGWSVIYYSLSWSVGFY
LYFTSPYFLDCDYIYLNWPHDQMTGIFKLYYLVQISSWLQQIVVINVEDRRKDHWQMFAH
HIITVALTTGSYYYYFTRIGHVILIIMDIVDIFLSTAKILKYCGFSVLCDYVFVVFLILW
FVFRHVVYNYIFYHTWAKARDLMGKAGLCGVDLYQKRCWTPFIIDVFLVLLGGLQIITLI
WLFLIIKVLIKVIKGTGAQDVRSDEDD
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatctagcaggttattaaattatcgtggcttcaatatgtcgagtgaggtaagg
cggagacatgcagaggagcctattgcagtatctgttgaacatcttcctagatgtgtagct
gaaaagagcgacaaaacaacttttaagagtaaaggacatactttgaaggggccgattaaa
gctacaagacatgtagttcattctaaggttgatttgtatacgtttttggttacatcgttt
gctcttctttttatttcgaccgggtatagttatagacctgatttttataggaagtttttg
agcttgcaatatgagcatagttctaatccaggtcactacgatattggtacagacgatatt
tatattgtgttcacagctgttatagtgctatgttggattagatcttttcttttggagttc
atgttgaagccgtttgcgtattataagtgtaatatcaagtcgtataaatcccagcagagg
tatggagaacaaggttggtctgtgatatattactctctttcgtggagtgttgggttctat
ctatactttacttcgccatatttccttgattgtgattatatttatttaaactggccgcat
gatcaaatgactggtatttttaagctgtattatttggttcagatctcatcatggttgcaa
cagattgttgttataaatgttgaagacaggcgtaaagaccactggcagatgtttgcgcac
catataataactgttgctctgaccacgggatcttactattattacttcaccagaattggt
catgtgattttgataattatggatatcgttgatatatttttatccactgcaaaaattttg
aagtattgtgggttttcagtgctatgtgactatgtctttgttgtgttcctgatactgtgg
ttcgttttcagacatgtagtttacaattatatattttatcacacttgggcaaaggcaaga
gatctcatgggtaaggctggtctttgcggcgtcgatctgtaccaaaaacgatgctggacg
ccttttattattgatgtgtttttagtgttattaggcggcctgcagataatcactcttatt
tggttgtttttaatcatcaaagttttgatcaaggttattaagggtactggtgcgcaggat
gtgcgtagcgatgaggatgattaa

DBGET integrated database retrieval system