KEGG   Eremothecium cymbalariae: Ecym_3488Help
Entry
Ecym_3488         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Ecym_3488
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Ecym_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(915087..916400)
Genome map
AA seq 437 aa AA seqDB search
MPLLQQNPPIQPPHYSRASQKLKSLLSSYGDNNNTTAAAAAKEINGPVPINMIEKSVVHP
PRTIYTKANFSIPGHYEVLQMLGKGSYGTVVSAIDNFNPNYPIRIAIKKITNIFQREVLL
KRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGLYCYQELIDYDLARVIHSNVQFSEF
HIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARGISPLFTNTKTS
NHITNYVATRWYRAPELILSHKRYNKSIDMWAIGCILAEFYGRKPIFMGQDSMHQISEIV
KVLGTPSRDTIIKYGSSRAYDIFCPPKPQYAKIPWIEIYSFASGEALDLIERLLDWDPDR
RLTVEESIEHDFVKTVRDKNDEPLCPHGPFNFSYEAEFKSMSNLREVLYAEVKQFQEECA
TKDIVPSLPVPQQIYPI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgcctctattgcaacagaaccctccgattcagccacctcattacagtcgtgcatcccaa
aagttaaagagtttgttgagttcatatggggacaacaacaatacaacggcagcagcagca
gcaaaagaaataaatggaccagttccaattaacatgattgaaaaatcagtggtccatcct
ccaaggaccatctacacaaaggctaatttttctattcctggacactatgaagttttacag
atgttgggtaaaggttcatatggcaccgtagtatctgccattgataactttaatccaaac
tatccaatacgtattgccatcaaaaaaattaccaacatattccaaagagaggtgctattg
aaacgcgctatcagagagttgaaatttatgcactatttcaagggacataaaaatatcgtg
tccctaattaatcttgaaattgttaacgaaaagccgtacgacgggttatattgttaccaa
gagttaatagattatgacttggctcgtgtcattcattctaatgtccaattttcagaattc
catatcaagcatttcacttaccaaattttatgtggtgtgaaatacattcacagcgcggat
gtcatacaccgtgacctcaaacctggtaatatattgtgtagtatttctggacagttgaag
atctgcgattttggtttggcaagaggaatatcaccattgtttacaaacacaaaaacatct
aaccacatcacaaattatgttgcaactcgttggtatagagctcctgaattaatcttatcg
cataaaagatataacaaatccatcgatatgtgggccattggatgtattctcgctgaattt
tacggaagaaaaccgatttttatgggccaggattccatgcatcagatctccgagattgtt
aaagttctaggaaccccatcgagagacaccataataaaatatggctcatccagagcatac
gatatattctgccccccaaaacctcaatatgctaagatcccatggatagaaatctattca
tttgcaagtggggaagcattagatttgattgaacgactactcgattgggaccctgacaga
agattgacagttgaggaatccatcgaacatgattttgttaaaacggttagggataaaaat
gacgaacctttatgcccacatggaccctttaacttctcctatgaagccgagttcaagtct
atgtccaacttgagagaagtactatatgcagaggtaaagcaattccaagaagaatgcgca
acaaaggatattgttccgtctcttccagttccccaacaaatctatccaatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system