KEGG   Eremothecium cymbalariae: Ecym_3570Help
Entry
Ecym_3570         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
erc  Eremothecium cymbalariae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ecym_3570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(1081527..1081859)
Genome map
AA seq 110 aa AA seqDB search
MPAPFKPGNAKKGGTLFKTRCLQCHTTEQGGPHKVGPNLHGVFGRNSGQAAGYSYTDANI
KKNVLWDEQSMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLITYMLKACK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatttaaaccgggtaacgctaagaaaggtggtactctatttaagaccaga
tgtttgcaatgtcatactacggaacaaggcggaccacacaaagttggtcctaacttgcac
ggtgtattcggtagaaactccggtcaggccgcagggtactcctacactgatgcgaacatc
aagaagaacgttctatgggacgagcaaagcatgtcggattatttggaaaacccaaagaaa
tacattcccggtaccaagatggcatttggtggattaaagaaggaaaaggacagaaacgac
ttgattacctacatgctcaaggcttgtaaatag

DBGET integrated database retrieval system