KEGG   Eremothecium cymbalariae: Ecym_4131Help
Entry
Ecym_4131         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
erc  Eremothecium cymbalariae
Brite
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ecym_4131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:276894..277292
Genome map
AA seq 132 aa AA seqDB search
MSSKASKAPASKAPAEKKPAAKKTSSSGDVSKKRTKTRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaaagcatccaaagcacccgcctccaaggcaccagctgagaagaaaccagca
gccaagaagacgtcgtcctccggcgatgtgtcgaagaagagaaccaagaccagaaaggag
acgtactcgtcgtatatctacaaggtgttgaagcagacgcacccggacaccgggatttcg
cagaagtccatgtcgattttgaactcgtttgtcaacgacatctttgagcggatcgcgtca
gaggcgtccaagttggctgcgtacaacaagaagtcgaccatctcagccagggagattcag
accgcggtgcggttgattttgcccggtgagttggccaagcacgcggtgtctgagggcacg
cgtgcggtgaccaagtactcgtcgtccacacaggcgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system