KEGG   Eremothecium cymbalariae: Ecym_4131Help
Entry
Ecym_4131         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:276894..277292
Genome map
AA seq 132 aa AA seqDB search
MSSKASKAPASKAPAEKKPAAKKTSSSGDVSKKRTKTRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaaagcatccaaagcacccgcctccaaggcaccagctgagaagaaaccagca
gccaagaagacgtcgtcctccggcgatgtgtcgaagaagagaaccaagaccagaaaggag
acgtactcgtcgtatatctacaaggtgttgaagcagacgcacccggacaccgggatttcg
cagaagtccatgtcgattttgaactcgtttgtcaacgacatctttgagcggatcgcgtca
gaggcgtccaagttggctgcgtacaacaagaagtcgaccatctcagccagggagattcag
accgcggtgcggttgattttgcccggtgagttggccaagcacgcggtgtctgagggcacg
cgtgcggtgaccaagtactcgtcgtccacacaggcgtag

DBGET integrated database retrieval system