KEGG   Eremothecium cymbalariae: Ecym_4207Help
Entry
Ecym_4207         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecym_4207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_4207
   00620 Pyruvate metabolism
    Ecym_4207
   00640 Propanoate metabolism
    Ecym_4207
  Energy metabolism
   00680 Methane metabolism
    Ecym_4207
Enzymes [BR:erc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ecym_4207
Lipid biosynthesis proteins [BR:erc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ecym_4207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:432854..434917
Genome map
AA seq 687 aa AA seqDB search
MSSCKEYKVVHEAKDAGFRYAPEHFKRSRVGEAYIKDMSEYEAMYKRSIEEPEKFFGEKA
HEFLYWDKPFTKVKSGSLDRGDTAWFLNGELNASYNCVDRHAFANPDKTAIIYEADDESE
NRIITYGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIPEAVVAMLAIARLGAIHSVIFA
GFSSGSLKDRVVDAGCKVVITCDEGRRGGKTVHTKKIVDEGLHGVEMVQRILVFQRTGTD
GIPMKPGRDYWWHLEAEKHRGYLPHVPVNSEDPLFLLYTSGSTGSPKGVVHTTGGYLLGA
VMTTRYVFDIHPEDILFTAGDVGWITGHTYALYGPLALGVATVIFESTPAYPDYGRYWRI
VERHRVTHFYVAPTAMRLIKRVGESEIAKYDTSSLRVLGSVGEPIAPDLWEWYNEKVGLN
NCVICDTMWQTESGSHLIAPLAGVIPTKPGSATVPFFGIDACIIDPVTGVQLEGNDVEGV
LAIKSPWPSMARSVWNNHNRYIDTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVS
GHRLSTSEIEAALVEHENVSEAAVVGITDELTGQAVIAFVSLKENPTEMMSSDDTLPVQI
PVDKLRRELILQVRGEIGPFAAPKSVIVVKDLPKTRSGKIMRRILRKISSKEADQLGDLS
TLANPEIVSTIISAVEAQFFAPKKLTN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctgcaaggaatacaaggttgtgcacgaggcaaaggatgctgggtttcgttat
gcacctgagcactttaagaggagcagggttggggaagcttatatcaaggatatgagtgaa
tacgaggcgatgtataagcgatcgattgaagagccggaaaaattctttggtgaaaaggcc
catgagtttctatattgggacaaaccttttaccaaggtgaagtcaggtagcttggataga
ggagatacggcgtggtttttgaacggagagttgaatgcatcgtacaactgtgttgacaga
cacgcttttgccaatccagataagacagcgatcatctatgaggctgacgatgagtctgag
aaccggattatcacttatggagagttgttgagacaggtgtctgaagttgcaggggttttg
aaatcttggggggtgaagaagggggatacagttgcggtttatttgcctatgattcccgag
gcagtagtagcgatgttagctattgcgcgtttgggtgctattcattctgttatattcgct
gggttttcatctgggtcgttaaaggatagagttgtggatgcaggatgcaaggtggttatc
acatgtgatgagggacggagaggcggcaagacggtccacactaaaaaaattgtggacgaa
ggtctacatggcgtagagatggttcagcggattcttgtcttccaaagaacgggtaccgat
ggtatcccaatgaagccaggtagggattactggtggcacttggaagctgaaaaacaccgg
ggttacttgccacatgttccagttaattctgaggatccattgttcctcttatatacttct
gggtccacgggttcacccaagggagtcgttcatacaacgggcggatacttgttaggcgct
gtaatgacaacgagatacgtgtttgatattcatccagaggatatcttgtttactgctggt
gatgtcggctggattactggccacacatatgcactctatggtccattggcattgggagta
gctaccgtcatctttgagtccactcccgcatacccagactacggtagatattggaggatt
gttgaacgtcacagagtcacacatttttatgtcgcgccaacagctatgcggttaatcaaa
cgtgtcggtgagagtgagattgcaaagtatgacacttcatcactaagggttttaggttct
gtgggcgagcccatcgcacctgatttatgggagtggtataacgaaaaagtcggactcaat
aattgtgtcatctgtgacacaatgtggcaaactgagtctggatctcatttgatcgctcca
ttagccggcgttattccaacaaaaccaggatcggcgactgtaccattttttgggattgac
gcctgcatcattgaccctgttacaggagtgcaattagagggcaatgacgtagagggtgtt
ctcgccatcaaatctccttggccatcaatggctagatccgtttggaataaccataaccgt
tatattgacacctacttgaagccatacccaggttactactttactggcgatggtgcaggc
agagatcacgacggttactattggatcaggggaagggtagatgacgtggtcaacgtctca
ggacataggctatcgacttcggaaatcgaagcagctttggttgaacacgagaacgtttct
gaggctgctgtggttggtattactgatgaattaaccggccaagctgtgatagcttttgtc
agcctgaaagaaaatccgacagaaatgatgtcatcagatgatacactacctgtgcaaatc
ccggtcgataaattacgtcgtgaactgattttacaagtcagaggagaaattggacccttt
gcagcccccaaatcagtaatagtagtcaaagatttacctaaaaccagatccggaaagatc
atgcgtagaatattgagaaaaatatcctccaaagaagctgaccagttgggtgacttgtcg
acgctagccaacccggaaatcgtgtcgaccattatctcagctgtagaagcacaatttttc
gctccaaaaaagctaacaaactaa

DBGET integrated database retrieval system