KEGG   Eremothecium cymbalariae: Ecym_4207Help
Entry
Ecym_4207         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:erc01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:erc00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:erc00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:erc00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:erc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:432854..434917
Genome map
AA seq 687 aa AA seqDB search
MSSCKEYKVVHEAKDAGFRYAPEHFKRSRVGEAYIKDMSEYEAMYKRSIEEPEKFFGEKA
HEFLYWDKPFTKVKSGSLDRGDTAWFLNGELNASYNCVDRHAFANPDKTAIIYEADDESE
NRIITYGELLRQVSEVAGVLKSWGVKKGDTVAVYLPMIPEAVVAMLAIARLGAIHSVIFA
GFSSGSLKDRVVDAGCKVVITCDEGRRGGKTVHTKKIVDEGLHGVEMVQRILVFQRTGTD
GIPMKPGRDYWWHLEAEKHRGYLPHVPVNSEDPLFLLYTSGSTGSPKGVVHTTGGYLLGA
VMTTRYVFDIHPEDILFTAGDVGWITGHTYALYGPLALGVATVIFESTPAYPDYGRYWRI
VERHRVTHFYVAPTAMRLIKRVGESEIAKYDTSSLRVLGSVGEPIAPDLWEWYNEKVGLN
NCVICDTMWQTESGSHLIAPLAGVIPTKPGSATVPFFGIDACIIDPVTGVQLEGNDVEGV
LAIKSPWPSMARSVWNNHNRYIDTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVS
GHRLSTSEIEAALVEHENVSEAAVVGITDELTGQAVIAFVSLKENPTEMMSSDDTLPVQI
PVDKLRRELILQVRGEIGPFAAPKSVIVVKDLPKTRSGKIMRRILRKISSKEADQLGDLS
TLANPEIVSTIISAVEAQFFAPKKLTN
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcctgcaaggaatacaaggttgtgcacgaggcaaaggatgctgggtttcgttat
gcacctgagcactttaagaggagcagggttggggaagcttatatcaaggatatgagtgaa
tacgaggcgatgtataagcgatcgattgaagagccggaaaaattctttggtgaaaaggcc
catgagtttctatattgggacaaaccttttaccaaggtgaagtcaggtagcttggataga
ggagatacggcgtggtttttgaacggagagttgaatgcatcgtacaactgtgttgacaga
cacgcttttgccaatccagataagacagcgatcatctatgaggctgacgatgagtctgag
aaccggattatcacttatggagagttgttgagacaggtgtctgaagttgcaggggttttg
aaatcttggggggtgaagaagggggatacagttgcggtttatttgcctatgattcccgag
gcagtagtagcgatgttagctattgcgcgtttgggtgctattcattctgttatattcgct
gggttttcatctgggtcgttaaaggatagagttgtggatgcaggatgcaaggtggttatc
acatgtgatgagggacggagaggcggcaagacggtccacactaaaaaaattgtggacgaa
ggtctacatggcgtagagatggttcagcggattcttgtcttccaaagaacgggtaccgat
ggtatcccaatgaagccaggtagggattactggtggcacttggaagctgaaaaacaccgg
ggttacttgccacatgttccagttaattctgaggatccattgttcctcttatatacttct
gggtccacgggttcacccaagggagtcgttcatacaacgggcggatacttgttaggcgct
gtaatgacaacgagatacgtgtttgatattcatccagaggatatcttgtttactgctggt
gatgtcggctggattactggccacacatatgcactctatggtccattggcattgggagta
gctaccgtcatctttgagtccactcccgcatacccagactacggtagatattggaggatt
gttgaacgtcacagagtcacacatttttatgtcgcgccaacagctatgcggttaatcaaa
cgtgtcggtgagagtgagattgcaaagtatgacacttcatcactaagggttttaggttct
gtgggcgagcccatcgcacctgatttatgggagtggtataacgaaaaagtcggactcaat
aattgtgtcatctgtgacacaatgtggcaaactgagtctggatctcatttgatcgctcca
ttagccggcgttattccaacaaaaccaggatcggcgactgtaccattttttgggattgac
gcctgcatcattgaccctgttacaggagtgcaattagagggcaatgacgtagagggtgtt
ctcgccatcaaatctccttggccatcaatggctagatccgtttggaataaccataaccgt
tatattgacacctacttgaagccatacccaggttactactttactggcgatggtgcaggc
agagatcacgacggttactattggatcaggggaagggtagatgacgtggtcaacgtctca
ggacataggctatcgacttcggaaatcgaagcagctttggttgaacacgagaacgtttct
gaggctgctgtggttggtattactgatgaattaaccggccaagctgtgatagcttttgtc
agcctgaaagaaaatccgacagaaatgatgtcatcagatgatacactacctgtgcaaatc
ccggtcgataaattacgtcgtgaactgattttacaagtcagaggagaaattggacccttt
gcagcccccaaatcagtaatagtagtcaaagatttacctaaaaccagatccggaaagatc
atgcgtagaatattgagaaaaatatcctccaaagaagctgaccagttgggtgacttgtcg
acgctagccaacccggaaatcgtgtcgaccattatctcagctgtagaagcacaatttttc
gctccaaaaaagctaacaaactaa

DBGET integrated database retrieval system