KEGG   Eremothecium cymbalariae: Ecym_4258Help
Entry
Ecym_4258         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
erc  Eremothecium cymbalariae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ecym_4258
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Ecym_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:537634..539331
Genome map
AA seq 565 aa AA seqDB search
MVKADPRSSKSESQLAGKGSWSRSNSRTRKPLLPRTKSSQRLIRTISVEQKSEDASNALA
DELSSSLLQLSLGSDSHEFIEVPFVKATLDITLPMDYLKVDVLHMIQSLKIPKWCKASGK
PLVTNPNELTLTMITGTMTNAIYKVERNKHTRLPSLLLRVYGPNVESIIDRAYELETLAR
LSFQNIGPSLFGCFNNGRFEQFLENSKTLTKDDIRDWKTAQRIARRMKEFHGGVPLLEWE
KKHCIAWSRIDKWVSKMDSSEWIQNIDHLKGALLTSDWTHFKNIINKYRLWLDATGESSK
PLVFCHNDTQYGNLLFTSPVITPTTSTPLAASSSATSLSDSLFLTESNISLEDIINPSVE
DQKQDSKLVVIDFEYAGPNPAAYDLANFLSEWMSDYHCTDCYKTFEDKFPKREEILNFVY
SYTSHLRNKQPPVEEEVRNLYNSIIRWRPCVSLHWSLWGLIQSGKLDSKPQTSTVVEEEG
PGGEKYIITLEDKEPYDSDDLTYDEDVNPNNLKEATGADIHSFDYISYAKEKISVFYGDL
VQLGVIEEADLPESTPLKKLDVKFL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggttaaggcagatcctaggtcctcaaaaagtgaatctcaattagccgggaagggctcg
tggtctaggtcaaatagccggactagaaaacctctgctaccgaggactaagtcttcacag
aggttaattcgcacgataagcgttgagcaaaaaagtgaagacgcgtctaatgctcttgca
gatgagctatcgagtagtttgctgcagttatctttggggtctgattcacatgaatttatt
gaggtgccatttgtcaaggcgacgttggacatcacattgccgatggattatttgaaggtc
gatgtgttacatatgatccagagcttaaagattcccaaatggtgtaaggcaagcggcaag
ccgcttgttacaaatcctaacgaattgacattgactatgatcacaggtacaatgacgaac
gccatctataaggtggaaaggaacaagcataccaggctccctagtttattgttgcgggtg
tatggaccgaatgtggaatcgattattgaccgtgcatatgagttagaaacattagcaaga
ctttctttccagaatataggtccttctttatttgggtgctttaataacggtaggtttgag
cagtttttggaaaattccaagacgttgacgaaggatgatatcagagattggaagacagca
cagagaatagcacgtaggatgaaagaatttcacgggggtgttcctcttcttgaatgggaa
aagaagcactgcatagcatggagtcgaattgacaaatgggtatccaagatggattcctct
gaatggattcaaaatattgatcatttgaaaggagctttgctcacctcagattggactcat
ttcaaaaatatcatcaacaagtatagattatggcttgatgcaaccggtgaatcttctaag
cctctagtattctgtcacaacgatacacagtacgggaatttgctatttacctcgcctgtt
attacaccgacgacatctactcctttggcagcatcttcttcagcaacatcattatctgat
tcattattcctaactgagagcaacatatctttagaagatattattaatccatccgttgaa
gatcagaagcaagactccaaattggtagtaattgattttgaatatgcaggaccgaatcca
gcagcttatgatttagccaatttcctatctgagtggatgtcggactatcactgtaccgac
tgttacaaaacctttgaggataaatttccgaagagggaggaaattctaaatttcgtttat
tcctacacttcccatttaagaaataaacaacctcccgtggaagaagaagtccgtaacttg
tacaatagcattatcagatggagaccctgcgtatccttacattggtctttatgggggctg
attcaaagtggtaagctagacagtaaacctcaaacctcaaccgtcgttgaggaagaaggt
cccggaggagaaaaatatataattaccctcgaagataaggagccatatgacagtgacgat
cttacatatgatgaggacgttaatcccaataacttgaaggaagcaacaggtgcagatatc
cactcttttgattatatctcttatgccaaagaaaagatcagcgtcttttatggagatctc
gtacagctaggtgtcattgaagaagctgatttaccggagagtacgccattaaaaaagttg
gacgtaaagttcttgtaa

DBGET integrated database retrieval system