KEGG   Eremothecium cymbalariae: Ecym_4259Help
Entry
Ecym_4259         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
erc  Eremothecium cymbalariae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecym_4259
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecym_4259
  Amino acid metabolism
   00310 Lysine degradation
    Ecym_4259
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ecym_4259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(539811..541112)
Genome map
AA seq 433 aa AA seqDB search
MLRSSVRSSFRSLRPSAIQVYQRAFSVGNVSKQVCLCSNILGETVRMPVLQKTTFRYGST
SVPVPPMAESLTEGSLKEYTKQVGEYVAQDELLATIETDKIDIEVNSPISGTITKLNFQP
EDTVTVGDELAQIEEGGEPAAASASKPEVEEATTKKEESGAPAAPAAAAPPKVSSADAKK
PTPAVSEPVSATAPQQALGNFSRTERRVKMNRMRMRIAERLKESQNTTASLTTFNEVDMS
ALLEMRKLYKDEIIKNKGVKFGFMGLFSKAVALAQKDVPSATGGIEGDQIVYRDYTDISI
AVATPKGLVTPVVRNVESLSVLEIEEEIVRLSKKARDGKITLEDMAGGNFTISNGGVFGS
LYGTPIINTPQTAVLGLHGVKERPVTVNGNIVSRPMMYLALTYDHRLLDGREAVTFLKTI
KELIEDPRKMLLM
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgttgagatcttcagttcgttcatcattcaggtcgctaaggccttcagcaattcaagtt
taccagcgggcatttagtgtagggaacgtttctaagcaagtatgtttgtgttcgaacata
ttgggcgagacagttaggatgcctgtgttgcaaaagacaacctttcgttatgggtcaact
tcagttccggttccaccaatggctgaatcgttgacggagggttcgttaaaggagtataca
aaacaggttggtgaatatgttgcgcaggatgaattattggctacgattgaaaccgacaag
attgatattgaggttaattcccctatatctggtaccataaccaagttgaatttccaaccg
gaggatacagttacagttggtgatgagttggcgcagattgaggaaggtggagaaccggca
gcagcaagtgcaagtaagccagaggtggaggaagctacaacaaagaaggaagaatcagga
gctccagcagccccagcagcagcagcccctcctaaagtttcttctgcagatgcaaagaag
cccactccagcagtatctgagccagtttctgccacagcaccacaacaggcattagggaac
ttttcacgtacggaacgcagggttaaaatgaaccgtatgagaatgagaattgcagaaagg
ttaaaggaatctcagaataccactgcctctttgactactttcaatgaagttgacatgtct
gcattactagaaatgagaaaattgtacaaggacgagattatcaagaataagggtgtcaag
tttggctttatgggtctcttctcaaaggccgtagctttggctcaaaaagacgttccttct
gctaccggaggcatcgagggagaccaaattgtttaccgcgattacacagatatatctatt
gccgttgccactcctaaaggtttagttacaccagtggtccgtaatgttgagtcattatcc
gttttggaaatcgaggaagaaatcgtcagattaagcaagaaggcacgtgacggtaaaatc
actttggaagatatggcaggaggcaactttactatctcaaatggcggtgtcttcggctcc
ttgtatggaacaccaattatcaacacccctcaaactgcagttttaggtctacatggtgtg
aaggaaagaccagtgactgtgaatgggaatattgtttctagaccaatgatgtatttggcc
ctaacttatgaccataggttattggatggtagggaagccgttaccttcttaaagacgatc
aaggaattgattgaggatcctagaaaaatgttgctaatgtag

DBGET integrated database retrieval system