KEGG   Eremothecium cymbalariae: Ecym_4266Help
Entry
Ecym_4266         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
erc  Eremothecium cymbalariae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Ecym_4266
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Ecym_4266
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Ecym_4266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(564935..566329)
Genome map
AA seq 464 aa AA seqDB search
MASQEEFFRTQIFGTVFEITNRYADLNPVGMGAFGLVCSAVDTYTQQPVAIKKIMKPFST
AVLSKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
LQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPKDV
IDTICSENTLKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAADALAHP
YLAPYHDPTDEPVADAKFDWNFNDADLPVDTWRVMMYSEILDFHQIPDSQINPNDTFDDQ
VAAATAAAEAARQQQQREQRDQVQQQQQHQGQEDQHQDQGHGQRQRQEHHQEQPQEQRQE
QQQQAPTSNSIKSADLAVSLNTSVPNETLSNFACQAAQYANDFE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctagccaggaagaattttttaggacgcaaatatttgggacggtgtttgagattacg
aatcggtatgcggatctgaatcctgtgggtatgggggcatttgggttggtgtgttctgca
gtagatacgtatacgcagcaaccggttgctattaagaagatcatgaagccattctccaca
gcggttttgtccaagcggacgtaccgggagttgaaattattgaaacatttacgacatgaa
aatctgatttgtctagaggatattttcctatcacctttagaagatatatattttgtgacg
gaattgcaggggacagatttgcatcgattattacagaccagaccgcttgaaaaacaattt
ttacagtattttctttatcagattttgcgtgggttgaagtatgttcattcggcaggggta
attcatagggatttgaagcctagtaatattctgatcaatgagaattgcgatttgaagatc
tgtgattttggtttggcaaggatacaggacccgcaaatgactgggtatgtttctacgaga
tattatcgggcacccgagattatgttaacttggcaaaaatataatgtggaggtggacatt
tggtccgctgggtgcatttttgctgagatgattgaagggaagcctcttttcccgggtaaa
gaccatgtacaccaattttcaatcatcacagacttgttggggtcgcctccaaaggatgtg
attgatactatctgttctgaaaacacgcttaaatttgttacttcgttgccgcatcgagac
cctgtgccatttactgaacgttttaagaatttgaagcccgacgcagttgacttgcttgag
aaaatgttggtttttgaccctaaaaagagaattactgcagcagatgctctggcccaccct
tacttggcgccttatcatgatcctacggatgagccagtggctgatgccaaatttgattgg
aattttaatgatgcggacttgcctgtcgacacttggcgtgtgatgatgtattccgaaatt
ttggactttcatcagattccagattcgcagatcaatccgaatgatacatttgatgaccag
gtagccgctgcgactgcagctgctgaggctgcacggcagcagcagcagagagaacagcgt
gatcaggtacagcagcaacagcagcatcaaggacaggaggatcaacatcaagaccaagga
catgggcagcggcagcggcaggaacatcatcaggagcagccgcaagaacagcggcaagaa
cagcagcagcaagcacccactagtaattctattaaaagtgctgatctcgctgtatcgtta
aatacctctgttccaaatgaaacattgagtaactttgcttgtcaagcggctcagtatgct
aatgattttgaataa

DBGET integrated database retrieval system