KEGG   Eremothecium cymbalariae: Ecym_4328Help
Entry
Ecym_4328         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecym_4328
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ecym_4328
Enzymes [BR:erc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ecym_4328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:704013..705686
Genome map
AA seq 557 aa AA seqDB search
MKNSGNDLDAIQQQAAAEAVVVRQWWAGSRWQKTKRIYSAEDIVKRRGTFPPVQYPSSVM
ADKLYRLLSEHARKGTVAQTFGAMDPLQVTQMAKYLDTVYVSGWQCSSTASTSNEPGPDL
ADYPMDTVPNKVDHLFKAQLFHDRKQREARLACSSQRELDELGPEIDYLRPIIADGDAGH
GGLTAVYKLTKMFIERGAAGIHMEDQTSSNKKCGHMAGRCVIPVQEHINRLITVRMCADV
MGSNLVLVARTDSEAATLISSTIDVRDHYFIVGATNPEVREGLAEVLNAAQMAGVYADQL
ARIENEWNSRAKLRLFHEAFADKVNENRHIKDKQGVIAKFNAKVSPFTGASLRQMQALSR
ELIGEEIFFDWDLPRANEGLYRYKGGTDCAIMRARAFAPHADLVWMESNYPDYQQAKDFA
VGVTEKFPGKWLAYNLSPSFNWPRAMSPKEQETFIQRLGKLGYVWQFITLAGLHTSALAI
DNFSREFSRQGMRAYAQGIQQREMDEGVDVLKHQKWAGAEYIDGILKLAQGGVSATAAMG
KGVTEEQFNSESAEAKL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagcgggaatgatttggacgcgattcagcagcaggcagcagctgaagcggtt
gtggtgaggcaatggtgggctgggtcgaggtggcagaagacgaagcggatctacagtgct
gaggatattgtcaagagacgtggtactttccctcctgtgcagtatccatcgtctgtgatg
gcagataagctgtataggcttttgtcggagcatgcgaggaaagggactgttgcgcagaca
tttggggcgatggatcctttgcaggtgactcagatggccaagtatttggatacggtttat
gtttctggatggcagtgtagttctacggcgtctacttccaatgagccagggccagatctt
gcagattaccctatggacacagtgcctaataaggtggatcatttgtttaaggcgcagctg
tttcatgacaggaagcagcgggaggcccggttggcgtgctcgagccaacgggagctggac
gagttagggcctgagattgattacttgaggcctattattgctgatggagatgcagggcat
ggtgggctgacggcagtttacaagctgaccaagatgtttattgagcgcggtgcagcgggg
attcatatggaggaccagacgtccagtaacaagaagtgtggtcacatggcgggccgttgt
gtgatcccggtacaggagcatatcaatagattgataacggtgagaatgtgtgccgatgtt
atggggtcgaacttagttcttgttgcacgtacagactcggaggccgcaacacttatcagt
tcgaccattgatgtcagggaccattattttatcgtcggagcgacaaaccccgaggtcaga
gagggattagcagaggttttgaatgccgcgcaaatggcgggcgtatatgcggatcagctt
gcacggattgagaatgaatggaacagccgggccaagttgagattgtttcatgaggccttc
gctgataaggtgaatgagaacagacatataaaggataaacagggtgtgatcgcgaaattc
aacgctaaggtcagcccgtttactggagcgtctttaagacagatgcaggccttgtcacgt
gaattgattggagaagaaatattcttcgattgggatctacctcgtgctaacgaaggtttg
tatcgttacaaaggtgggacagactgtgccattatgagggcacgtgcttttgctcctcat
gcggatttggtctggatggaaagtaactatccggattaccaacaggccaaagattttgct
gtaggagttacagagaaattcccaggcaaatggctcgcttataatctatctccaagtttt
aactggcccagagccatgtctcctaaggagcaagaaacctttatacagaggttgggcaag
ttgggatacgtctggcagttcatcactttggctggattgcacactagtgctctggccatc
gataacttctctcgcgaatttagcagacaaggtatgagagcttacgcacagggtattcaa
cagagagaaatggacgagggtgttgatgtcttaaagcatcaaaagtgggctggggctgaa
tacattgatggtatcctaaagctcgcccaggggggtgtttcagcaactgctgcaatgggc
aagggtgtgacggaagagcaattcaactccgaatctgctgaagcaaagttataa

DBGET integrated database retrieval system