KEGG   Eremothecium cymbalariae: Ecym_4334Help
Entry
Ecym_4334         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Ecym_4334
    1.3.1.94  polyprenol reductase
     Ecym_4334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(716478..717275)
Genome map
AA seq 265 aa AA seqDB search
MLQKMLYEYVSEDLVWYLIYVTYGVGFFSVLLAKYKLPLMLQYGKTLTLPRVGGHFSWYA
SLTVPRSYFTHFYTLSFLLSIINVCMFYRYLITWCICLHSLRRLLESVKVTVWGASSRMH
YAHYFVGIWFYSALNLTVYLQLSEDAATSMASDHINKMLPGIGLVLFIIASCDQLLNHIH
LAQLVKYSPPSRRLFKWVACAHYFDEVIIYISLALVGRTTRWSLTLASIWVLINLGVSSI
ETRRYYMSKFKSLPIAPYALIPFIL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgttacagaagatgctctatgaatatgtaagcgaagatcttgtatggtacttgatctat
gttacctatggtgtgggattcttttcagtactacttgcaaagtataagttacctttaatg
ctccaatatgggaagaccctaacactcccaagagtcggaggacatttttcctggtatgcg
tcactgactgttcctcgatcctatttcactcatttctatacgctctcatttctactttca
attatcaatgtctgcatgttttacaggtatctaattacatggtgtatatgcctgcattcc
ctcagaagattgttagaatcggtgaaagtaacagtatggggagcaagctctcgaatgcat
tatgcacactatttcgttggtatatggttttactctgcattaaatctaactgtgtaccta
cagttatccgaagacgctgctacgtctatggcatctgatcatattaacaaaatgttacct
ggtatcggattggtactgttcattattgcctcctgtgaccaacttctgaatcatattcat
ttagctcaacttgtaaaatactctcccccaagtcgcaggctatttaaatgggttgcgtgt
gcacattattttgatgaagttattatctacatatcattagcactagtagggagaaccaca
cgttggtcgctcacgttggccagtatctgggttctaataaacctaggggttagttctatt
gagactaggcgctactacatgtccaaattcaagagtttacctatagccccgtatgcacta
ataccctttattctgtag

DBGET integrated database retrieval system