KEGG   Eremothecium cymbalariae: Ecym_4348Help
Entry
Ecym_4348         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ecym_4348
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     Ecym_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 Iron_permease
Motif
Other DBs
NCBI-GeneID: 11470043
NCBI-ProteinID: XP_003646226
UniProt: G8JTQ6
Position
4:complement(742325..743191)
Genome map
AA seq 288 aa AA seqDB search
MAMPNILVVVAVGIILVTTYVLRKFIIAEPSTEMKKAGVLNKEWQEFPLIAKTAITHNTA
IYRFGLPKADDVLGLPIGQHISISGVINDKEVLRSYTPTSLDSDAIGYFEILIKSYPEGN
ISKMVAGLSIGDKIRVRGPKGFYNYKPNMYKKIGMVAGGTGISPMYQIMKAIFNNDNDKT
QVFLLYGNQTKDDILLKAELDAMVKAKPEQFNILYLVDKVSDGEKWEGKVGYITPAIMVE
HLPSPDISSQLLICGPPPMVSSVKRSAVSLGLQKAKPISKMGDQVFVF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgccaaatattttagttgtcgtagccgttggcataattttagtcactacatat
gtgttaaggaaatttattattgcagagccatcaacagaaatgaaaaaagcaggtgtgtta
aataaagaatggcaggaatttccattaatagctaagacagctattacgcataatacggct
atatacaggtttgggttaccaaaggctgatgatgttcttggattaccaattggtcaacat
atttctatttctggtgtgattaacgacaaggaggttctgagatcgtatacgcccacttcg
ttggattcggatgcaattggttactttgaaattttgattaaatcttatccggaagggaat
atttcgaaaatggttgctggtttgtctataggagataagatcagggttagaggcccaaaa
gggttttataactataagcctaacatgtacaaaaagattgggatggttgctggtgggaca
ggcatttcaccgatgtatcagatcatgaaggcaatctttaataatgataatgacaagact
caagttttccttctatatggtaaccagacgaaggatgatattctcttgaaggctgagtta
gatgcaatggttaaggctaagcccgaacagtttaacatcttataccttgtagacaaagta
tctgatggggaaaaatgggaaggcaaagtagggtatataacgcctgctattatggttgaa
catttaccaagtcctgacatatctagtcaattgttgatctgtgggccaccgccaatggtc
tcctcagttaagagaagtgcagtgtctttaggtttacaaaaggccaagccgatctctaaa
atgggcgatcaagtattcgtcttttga

DBGET integrated database retrieval system