KEGG   Eremothecium cymbalariae: Ecym_4348Help
Entry
Ecym_4348         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
erc  Eremothecium cymbalariae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:erc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(742325..743191)
Genome map
AA seq 288 aa AA seqDB search
MAMPNILVVVAVGIILVTTYVLRKFIIAEPSTEMKKAGVLNKEWQEFPLIAKTAITHNTA
IYRFGLPKADDVLGLPIGQHISISGVINDKEVLRSYTPTSLDSDAIGYFEILIKSYPEGN
ISKMVAGLSIGDKIRVRGPKGFYNYKPNMYKKIGMVAGGTGISPMYQIMKAIFNNDNDKT
QVFLLYGNQTKDDILLKAELDAMVKAKPEQFNILYLVDKVSDGEKWEGKVGYITPAIMVE
HLPSPDISSQLLICGPPPMVSSVKRSAVSLGLQKAKPISKMGDQVFVF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgccaaatattttagttgtcgtagccgttggcataattttagtcactacatat
gtgttaaggaaatttattattgcagagccatcaacagaaatgaaaaaagcaggtgtgtta
aataaagaatggcaggaatttccattaatagctaagacagctattacgcataatacggct
atatacaggtttgggttaccaaaggctgatgatgttcttggattaccaattggtcaacat
atttctatttctggtgtgattaacgacaaggaggttctgagatcgtatacgcccacttcg
ttggattcggatgcaattggttactttgaaattttgattaaatcttatccggaagggaat
atttcgaaaatggttgctggtttgtctataggagataagatcagggttagaggcccaaaa
gggttttataactataagcctaacatgtacaaaaagattgggatggttgctggtgggaca
ggcatttcaccgatgtatcagatcatgaaggcaatctttaataatgataatgacaagact
caagttttccttctatatggtaaccagacgaaggatgatattctcttgaaggctgagtta
gatgcaatggttaaggctaagcccgaacagtttaacatcttataccttgtagacaaagta
tctgatggggaaaaatgggaaggcaaagtagggtatataacgcctgctattatggttgaa
catttaccaagtcctgacatatctagtcaattgttgatctgtgggccaccgccaatggtc
tcctcagttaagagaagtgcagtgtctttaggtttacaaaaggccaagccgatctctaaa
atgggcgatcaagtattcgtcttttga

DBGET integrated database retrieval system