KEGG   Eremothecium cymbalariae: Ecym_4493Help
Entry
Ecym_4493         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Ecym_4493
Enzymes [BR:erc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Ecym_4493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(992456..994534)
Genome map
AA seq 692 aa AA seqDB search
MKCSLVLWLVSLLASFAYAEDTVITPDTPEDQEVSQIPPPLTVRNFEDTMSKNLHLVEFF
SPTCPQCLLLAPKWEDTWKSFHAEGMKLGISMERVNCLESGDLCNQENIKAYPSIKLYGP
GGFIQDYPRSSLRNQENFIKFMKDEAIRKENLLSVSETSRSLMLNSEQLSSYIEGRGEKP
VLISFWPSENLKNMSKRLSFANCAKCTNYQANWKTLSNLRAVKDIDIAHYNCMKDSTPCK
KLKLDHLVDSRRHSGGVFPAVALMLPGHGEDNIIMYKGSSFDPSDLAEFASRTYSNSQFP
SITELELNEMIRKPIEVGKPNDIFDSGKTFLVLYQDYKSSGGENLKVLSSLCKLLSGLPG
VYLYKSAANLPRLVQQNYYEMIKQINYNSSEPEKLANKQYLDLMTLSKHQSFFMFKQGSL
VPNVFYGNYEDVKTLNNWIEQNSLPMVNELKLDNFKQLIEFHGDVYDELAIQLVDTGNSA
SKAASKSYLISFLVSYHDFEKIRQDNNYKSFEEQSGVPQSSKDEEYFDEDSIQQLILRDR
HKVLLAYVDIHDNRILLNKLGLNINKRYYKNGDVLIVNKLNKKFYYDTDPFGQPLTTDSP
TYMKATLKALIFPESKPKQVVRQLLINSPFGHHLRFLDKVHQFGLLGWLCTLCVVFTALK
SPSLYRKHKTRRRYFAKRDSAGLLGKRRRLKD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgttctctggtattatggttggtttctctgttggcttcttttgcctacgctgag
gataccgtaattactcctgatacacctgaagatcaagaagtttcacaaattccaccacct
cttactgttagaaactttgaggatacgatgtctaagaacctacatttagttgagtttttt
agtccaacttgccctcagtgtcttcttttggcacccaaatgggaggatacttggaagagc
ttccatgcagaaggtatgaagttaggtatttcgatggagagggtaaattgccttgaaagt
ggtgatctctgtaaccaagagaatattaaagcttatcccagtatcaagttgtatggacct
ggaggattcattcaagattatcctaggtcgtcattaagaaatcaggaaaattttattaaa
tttatgaaagacgaagcaataagaaaggaaaacttgctttccgtttcagagactagtaga
agccttatgcttaattctgaacagctatcctcatatattgaaggaagaggtgaaaagcca
gtattgatttccttttggccatcggaaaatttgaaaaacatgagtaaaagattatcgttt
gctaattgtgcaaaatgtaccaattaccaggcaaattggaaaactctgtctaatttaagg
gcggtaaaagatatcgatattgctcattataattgcatgaaagattcaactccatgcaaa
aaattgaaattggatcatttagtagactcaagaagacacagtggcggtgtatttccggca
gtagctcttatgttacctggccatggagaagataacattataatgtataagggatcttct
tttgatccgtcagatttggcagaattcgcatctaggacgtattctaactctcaatttcca
tccattactgagcttgagctgaacgaaatgatacgtaaaccaattgaagttggaaaacca
aatgacatatttgatagcgggaaaaccttccttgttttgtaccaagactataagtcatct
ggtggagaaaatttgaaagttctaagttccttgtgtaaattactaagtggtttaccagga
gtttatttatacaaaagtgctgcaaatttgccaaggttggttcagcaaaactactatgaa
atgattaagcaaattaattacaatagctcagaaccagaaaaacttgcaaataaacaatat
ttggacttgatgacattatctaagcatcaaagtttctttatgttcaaacagggtagtctg
gttcctaatgtattctatggaaattacgaagatgttaaaacattgaacaattggatagag
caaaattctttgcccatggtcaatgagttaaaactagataacttcaaacaactaatagag
tttcatggagatgtttatgatgaattggccattcaacttgttgacaccgggaattctgct
tcaaaggcggctagcaaaagctatctgatcagtttccttgtttcgtatcatgacttcgag
aaaattaggcaagataacaattataagagctttgaagagcaaagtggtgtaccacaatcg
agcaaggatgaagaatactttgatgaagatagcattcagcaactgattttaagagatagg
cacaaagtgctgcttgcttatgtcgatattcatgataaccggatacttctgaataaactt
ggtctaaatataaacaagcgttattataaaaacggtgatgttctcatcgttaataaactg
aataaaaagttttattatgacacggatccctttgggcagcctttgacgactgattcccct
acctacatgaaggcgaccctaaaagcgttgattttccctgaatcaaagccgaaacaagtc
gttcgccaactattgataaactctccctttggtcatcacttaagattcctggacaaagtt
catcaatttggactccttggttggttgtgcactttatgtgtagtcttcactgcccttaaa
tcccctagcttgtacagaaaacataagactcgtagaagatatttcgctaaaagagattca
gctggtttgctgggaaagcgtagaagacttaaagattaa

DBGET integrated database retrieval system