KEGG   Eremothecium cymbalariae: Ecym_4510Help
Entry
Ecym_4510         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
erc  Eremothecium cymbalariae
Brite
Exosome [BR:erc04147]
 Exosomal proteins
  Proteins found in most exosomes
   Ecym_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(join(1019247..1019614,1019714..1019726))
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG
LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacaccgataatttgatagctactggcaaagtggacaaagccatt
atttattccagagctggggatacgatctgggcatcttctggtggtatgtcgttagaggcg
aatgagattagtgagatttctcaaggttttgacaatgcgggtgggttgcaatccaatgga
ttacatatccaaagtcagaaatttatgctactaagagctgacgataggtcgatttatggt
agacatgaagctgaggggataattgcagtcagaaccaagcaaactattttgattgcacac
taccctgcgggtgttcaagcaggtgaagctacaaagattgtcgaacagttagcagattat
ttgattagtgtccaatactga

DBGET integrated database retrieval system