KEGG   Eremothecium cymbalariae: Ecym_4647Help
Entry
Ecym_4647         CDS       T02237                                 

Definition
hypothetical protein
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1261859..1263511
Genome map
AA seq 550 aa AA seqDB search
MSQHFFQPRSLKRKNFKKLTLESSSHESRDEGTDVFEGEPARQERQEPVPIGRHERDDGM
IRGMVLSPQGLTTPSSKDKSRSGHPNSRQTSIGRSSSLSSSADEGGGNTHKASRTLSSQS
SSSSNDNGRSNGKLTLHMKRLKKPLNLKIEPQGVKSRVVIAQPSPTNSENSSNSISPITP
ENVMNNTRGHHSLSKKFSRLSIFHDDNNDIQLEDLVQLGKIGAGNSGTVVKTLHVPDSRI
IAKKSIPVENSELVRNQLMRELTIMKNVKDHINIVGFFGAYYTTITNHEIIILMEYMDCG
SLDKISGTYRRSCTRNDEPINSSTSWFTELSLSKISYAVLNGLSYLYHEYKIIHRDIKPS
NILINSKGYVKICDFGVSKKMIDSIADTFVGTSTYMSPERIQGSCYSTKGDVWSLGLMII
ELVTGEFPLGGHNDTPEGILDLLQRIVNEGPPRLPYKGDFSSELVDFVNSCCVKDERKRS
SLQELMSHTYITKYNNNDDYQRTFRHWCKKIKKRVKEDKMIQREKIERAKLVNRQLERSA
QAATAARGGR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacacttcttccaacctaggagtttaaagcgaaagaatttcaagaagttaaca
ctggagtccagcagtcatgaatctagggatgaaggaactgatgtttttgagggtgagcct
gcgagacaagaaagacaggagccagtgcctataggcagacatgagagggatgatgggatg
attcgtgggatggttctttctccccaaggtctcacaactccttcaagtaaggataagagc
agaagtgggcatcccaatagtcggcagacctcaattggacgttcttcgtcgctgtcgtcg
tctgcagacgaaggcggtggaaatacgcataaggcgagtaggacattgtcttcgcagtcc
tcctcgtcctcaaatgataatgggcgatcgaatgggaagcttacgttgcatatgaagcgt
cttaagaagccgttgaatttgaagattgaaccacaaggagtgaagtcgagggtggttatt
gcacagccgagtcctactaattcggaaaattcgtcgaatagcattagtcctattacacct
gagaacgttatgaataacacacgtggacatcatagtttatcaaagaagttttcaaggtta
tctatctttcacgatgataacaacgatatacaacttgaagatctggttcagttgggcaag
attggtgctggaaattcgggtacagttgtaaagacgttacatgtaccggattcacgaatc
attgctaaaaagtcaattcctgtagagaacagcgagttggtcaggaaccagttgatgaga
gaacttactattatgaagaatgtgaaggatcacataaatattgttggattttttggcgca
tattacactacaataacaaaccatgagattattattcttatggagtacatggactgtgga
tctcttgacaagatctccggtacttataggcgttcttgcactagaaatgatgagccaatt
aattcttcaacttcgtggttcactgagctttccttgtcaaaaatttcatatgcagtatta
aatggactatcttatttatatcatgagtataagatcattcatcgagatattaaaccctct
aacatactgatcaactccaaaggttatgtcaaaatatgtgactttggagtttccaagaaa
atgattgactctattgccgacacctttgttggcacatctacttacatgtctccagagcgc
attcagggcagttgctactcgactaagggtgacgtgtggtcccttggtctcatgataata
gagttggtgactggcgaattccctctaggaggtcataatgacacacccgaaggcattcta
gatctattgcaaaggatagttaacgagggtccaccacgtctcccctataagggtgacttt
tcttcggaactagtcgattttgtcaatagctgctgtgttaaagatgaacgtaaacggtca
tctctgcaggaactcatgtcccacacttatataaccaagtacaacaacaacgacgattat
caaaggacatttagacactggtgtaaaaagatcaaaaaaagggttaaagaagacaagatg
attcagcgtgaaaagattgaaagggcaaagttggtaaatagacaattagagaggtctgca
caagctgctactgcagccagaggtgggaggtaa

DBGET integrated database retrieval system