KEGG   Eremothecium cymbalariae: Ecym_4647Help
Entry
Ecym_4647         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
erc  Eremothecium cymbalariae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:erc00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    Ecym_4647
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Ecym_4647
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Ecym_4647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1261859..1263511
Genome map
AA seq 550 aa AA seqDB search
MSQHFFQPRSLKRKNFKKLTLESSSHESRDEGTDVFEGEPARQERQEPVPIGRHERDDGM
IRGMVLSPQGLTTPSSKDKSRSGHPNSRQTSIGRSSSLSSSADEGGGNTHKASRTLSSQS
SSSSNDNGRSNGKLTLHMKRLKKPLNLKIEPQGVKSRVVIAQPSPTNSENSSNSISPITP
ENVMNNTRGHHSLSKKFSRLSIFHDDNNDIQLEDLVQLGKIGAGNSGTVVKTLHVPDSRI
IAKKSIPVENSELVRNQLMRELTIMKNVKDHINIVGFFGAYYTTITNHEIIILMEYMDCG
SLDKISGTYRRSCTRNDEPINSSTSWFTELSLSKISYAVLNGLSYLYHEYKIIHRDIKPS
NILINSKGYVKICDFGVSKKMIDSIADTFVGTSTYMSPERIQGSCYSTKGDVWSLGLMII
ELVTGEFPLGGHNDTPEGILDLLQRIVNEGPPRLPYKGDFSSELVDFVNSCCVKDERKRS
SLQELMSHTYITKYNNNDDYQRTFRHWCKKIKKRVKEDKMIQREKIERAKLVNRQLERSA
QAATAARGGR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaacacttcttccaacctaggagtttaaagcgaaagaatttcaagaagttaaca
ctggagtccagcagtcatgaatctagggatgaaggaactgatgtttttgagggtgagcct
gcgagacaagaaagacaggagccagtgcctataggcagacatgagagggatgatgggatg
attcgtgggatggttctttctccccaaggtctcacaactccttcaagtaaggataagagc
agaagtgggcatcccaatagtcggcagacctcaattggacgttcttcgtcgctgtcgtcg
tctgcagacgaaggcggtggaaatacgcataaggcgagtaggacattgtcttcgcagtcc
tcctcgtcctcaaatgataatgggcgatcgaatgggaagcttacgttgcatatgaagcgt
cttaagaagccgttgaatttgaagattgaaccacaaggagtgaagtcgagggtggttatt
gcacagccgagtcctactaattcggaaaattcgtcgaatagcattagtcctattacacct
gagaacgttatgaataacacacgtggacatcatagtttatcaaagaagttttcaaggtta
tctatctttcacgatgataacaacgatatacaacttgaagatctggttcagttgggcaag
attggtgctggaaattcgggtacagttgtaaagacgttacatgtaccggattcacgaatc
attgctaaaaagtcaattcctgtagagaacagcgagttggtcaggaaccagttgatgaga
gaacttactattatgaagaatgtgaaggatcacataaatattgttggattttttggcgca
tattacactacaataacaaaccatgagattattattcttatggagtacatggactgtgga
tctcttgacaagatctccggtacttataggcgttcttgcactagaaatgatgagccaatt
aattcttcaacttcgtggttcactgagctttccttgtcaaaaatttcatatgcagtatta
aatggactatcttatttatatcatgagtataagatcattcatcgagatattaaaccctct
aacatactgatcaactccaaaggttatgtcaaaatatgtgactttggagtttccaagaaa
atgattgactctattgccgacacctttgttggcacatctacttacatgtctccagagcgc
attcagggcagttgctactcgactaagggtgacgtgtggtcccttggtctcatgataata
gagttggtgactggcgaattccctctaggaggtcataatgacacacccgaaggcattcta
gatctattgcaaaggatagttaacgagggtccaccacgtctcccctataagggtgacttt
tcttcggaactagtcgattttgtcaatagctgctgtgttaaagatgaacgtaaacggtca
tctctgcaggaactcatgtcccacacttatataaccaagtacaacaacaacgacgattat
caaaggacatttagacactggtgtaaaaagatcaaaaaaagggttaaagaagacaagatg
attcagcgtgaaaagattgaaagggcaaagttggtaaatagacaattagagaggtctgca
caagctgctactgcagccagaggtgggaggtaa

DBGET integrated database retrieval system