KEGG   Eremothecium cymbalariae: Ecym_4711Help
Entry
Ecym_4711         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
erc  Eremothecium cymbalariae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ecym_4711
Translation factors [BR:erc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Ecym_4711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1392719..1393519)
Genome map
AA seq 266 aa AA seqDB search
MSWDDNEFEVPDVAKDQPIVESWDDDFRDDGEEALLESWDAEEKEVSKPKKKAVTVNKER
KSVDKVLLDIDTLDEKTRKELLRKAELDSDLNNAADLFGGLGVAEEHPRARALRKEQDLE
ESLSKPAGFTKQTPFETHPLFVELETKADYQELRKALSSAITGVAKKSQLNYSSALAIDL
IRDVAKPLSIESIKQSVATLNLLIREKEKQERQARLSKVKGGTATGGAGKKKAKTARPNL
GGAFKKDQEFALDNADYGDFDDGDFM
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggacgacaatgagtttgaagtacctgacgttgcaaaggaccaaccgattgtt
gaatcttgggatgatgattttagagatgatggtgaagaagcgttgttagagtcttgggat
gctgaggaaaaagaagttagtaagcctaaaaagaaggcggtaactgttaataaggagcga
aagtctgtagacaaggttttgttggatatagacactcttgatgagaagacccgtaaggag
ttattaaggaaggccgagctggattccgatttgaataatgctgcagacttatttggaggg
cttggagttgcggaagagcatcctcgggcacgggctctgcgtaaagagcaagatttggag
gaatcattgagtaagccagcaggttttacgaaacagactccttttgaaacacacccactt
tttgttgagttagagacgaaggccgattatcaagagttgaggaaggctttgtctagtgct
attacgggagtggcaaagaagtctcagttgaattattcaagtgcattggccatagatttg
atcagggatgtcgctaagccattgtcgattgagtccattaagcagagtgtggctactttg
aacttgttgatcagagagaaagaaaaacaagaaaggcaggctcggttgtctaaagttaaa
ggtgggactgctactggaggtgcaggtaagaagaaagctaagacagctagacccaattta
ggtggcgcatttaagaaggatcaggaatttgctctagacaatgctgattacggtgatttc
gatgatggcgactttatgtaa

DBGET integrated database retrieval system