KEGG   Eremothecium cymbalariae: Ecym_4744Help
Entry
Ecym_4744         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Ecym_4744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:complement(1451668..1453737)
Genome map
AA seq 689 aa AA seqDB search
MAIKFDKIDFAVICALALAVATYLKLDKLKELFSTDDSLVAVHSDSRDIVEVLTENNKDY
LVIYASQTGTGEDYAKKFAKELSSKFSLKVMCVDVENYDFDNLNSLPDNVIISIFVSTYG
EGDLPDAAIQFEEWLQSLNPGDLDNVKYTLFGLGNSTYEFYNGAAKKTDKLLQEASATLV
GTFGLADDGAATTDEDFLAWKDSIFEELKDVLALDEREVGFESSYEYTVLPKDSVDTASL
GEPISAYLPGRALSFNDSGKQLGPFDSTHPFVAPITTTKELLKSGDRNCVHAEFDISGSN
MKYSTGDHLAVWPSNSDEKVEKFLSTFDLDPDTVFNLKPKDNTIKEPFPVPTTIGSAVRY
YLEISGPISRQVFGSLLQYVTDPDVKEKLLVISKDKNKFAKEISSKYFDLTDALLYLSNG
QKWSFVPWEFLAETIPHLQPRYYSISSSSSSEKQTIHITAVVENFPNPTDHTLGQVTGVA
TNLLRHIHLSKTQQDVSDAKLPVHYNLSGPRNLYHNYKLPVHVRRSTFRLPSNPATPVIM
IGPGTGVAPFRGFIRERVKFISNNENIKLGKHLLFYGCRDENDFLYQEEWPNYAKVLGDC
FELIVAYSRIPSQKKTYVQHRLLEREKEVLDLINQGAFIYVCGDAKGMSQDVHKSLADIL
QRGKGITEEDAAEILKLFKTSGKYQEDVW
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcaagtttgataagatagattttgctgttatttgtgcgttagctttggctgtt
gccacatatttgaagttggacaagttgaaggaattattttctacagatgactcgttagtt
gcggtacactcagattcacgagacattgtggaggtgttaactgagaacaataaggattat
ttagtaatctatgcatctcagactggaactggtgaagattatgccaaaaagtttgctaag
gagctttcttcaaaattttccttgaaagttatgtgtgttgatgtggaaaactatgatttt
gataatttgaactcgttgccagataatgtgattatttcaatatttgtttccacctatgga
gaaggggatttacctgatgctgcaatacagtttgaagaatggttgcaatcattgaatcca
ggtgacttagataatgtgaaatacacactttttggtttgggaaactcaacctatgaattc
tacaacggtgcagccaaaaagacggacaaacttctccaggaagcttctgcaactttggta
ggtacttttgggttagctgatgatggtgctgcaacgacagatgaggactttttggcttgg
aaggatagtatatttgaggaattaaaggatgtattggctttagatgaaagagaagttggt
tttgagtcaagttacgagtacactgttttacccaaggattctgttgatacggcttcttta
ggtgagcctatatctgcatacctcccagggagagctctatcgttcaacgacagtggaaag
cagctgggcccattcgactcaactcatccgttcgtggctccaattactacaactaaggag
ttactcaaatctggtgatcgtaactgtgtccatgctgaatttgatatctctggaagcaat
atgaaatattctactggtgaccatctagccgtatggccatctaactctgatgaaaaggtc
gagaaatttctatcaacatttgatcttgatccagacactgtattcaacttgaaaccaaaa
gataacactattaaagaaccatttccagtgccaactacaattggttcggcggttagatac
tatttggaaatttcaggtcccatttcgagacaagtatttggctcgttgttacagtatgtc
accgatcctgatgtgaaagaaaagttgctagttatatccaaggataaaaataaattcgct
aaggaaatttcttccaaatattttgatcttactgatgcattgctttacttatcaaatggg
cagaagtggtcttttgttccatgggaatttttagcggaaactatccctcatttacaacct
cgttattattcaatatcttcctcttcttcttctgaaaagcagaccattcatataacagca
gttgttgaaaatttcccaaaccccacagatcacacactggggcaagttacaggtgttgct
actaatttgttaaggcatattcacttatccaagactcaacaagatgtttcagatgcgaag
ttaccagttcattacaatttatctggcccacgtaacctataccataactacaaacttcct
gtccatgttcgccgttccacatttaggttaccgtcaaaccctgctactccagtaataatg
attggcccgggaactggtgttgcaccattccgtgggtttatccgtgaacgtgtcaagttc
atctctaacaatgaaaatattaaactaggcaaacatttgttgttctatggctgtcgggat
gaaaatgactttttgtatcaggaagagtggcccaactatgccaaagtattgggagattgt
tttgaattgattgtggcatattctaggataccttcccagaagaagacctatgttcaacat
cgcctattagaaagggaaaaagaagttctagatttgattaatcaaggagcctttatttac
gtttgtggtgacgctaaaggtatgtcacaagatgtacacaaatcacttgcggacatcttg
caaagaggtaaaggtataacagaggaggatgctgctgaaatcttaaaattatttaaaacc
agcggcaagtaccaggaagatgtgtggtag

DBGET integrated database retrieval system