KEGG   Eremothecium cymbalariae: Ecym_4772Help
Entry
Ecym_4772         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
erc  Eremothecium cymbalariae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:erc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4:1503782..1504516
Genome map
AA seq 244 aa AA seqDB search
MVDSDESVQQVVRLPTPLNTKPSAPYRLSEPIEADGFSWPSLGARRRANETEEQEQQRVE
RISDAIKTILNELGEDISREGLLKTPERYAKAMLYFTKGYQDNLMGDVINNAVFQEDHDE
MVIVRDIEIFSLCEHHMVPFYGKVHIAYIPVQKVLGLSKLARLAEMYARRLQVQERLTKQ
IALALTAILKPKGVAVIVEATHMCMVSRGIQKSGSSTVTSCMRGCFQNSHRTREELLNLL
RSNK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggttgacagtgatgaatctgttcaacaggtcgttaggctgcctacccctttgaatacc
aaaccttctgcaccttatagattaagtgagcctattgaggcagatggtttttcttggcct
agtttaggggccagaagaagagcgaatgagactgaagaacaagaacagcaacgggtagaa
cgtatttctgacgcgatcaagaccatcctgaatgaactaggggaagatatcagcagagaa
ggtttgttgaagacgcctgaaaggtacgcgaaggcaatgctgtattttactaagggatat
caggataacctcatgggtgatgttataaacaatgctgtgtttcaagaggatcacgatgag
atggttatcgtgagggatattgagatattttctctttgtgagcatcatatggtgcccttc
tatgggaaggtccatatagcttatatacctgttcaaaaggtgttgggtctttccaagctt
gctaggttggctgaaatgtatgctagaaggcttcaagtgcaggagagactaacaaaacag
attgcactggcgcttactgcaattttgaagcctaaaggggttgcggtgattgttgaggct
acccacatgtgtatggtttctaggggtattcaaaaaagtggttcatccactgtaacctcg
tgtatgcgtggttgtttccaaaattctcataggacgagagaagaactgttgaacttattg
agaagcaacaagtag

DBGET integrated database retrieval system