KEGG   Eremothecium cymbalariae: Ecym_5013Help
Entry
Ecym_5013         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00010  Glycolysis / Gluconeogenesis
erc00620  Pyruvate metabolism
erc00640  Propanoate metabolism
erc00680  Methane metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecym_5013
   00620 Pyruvate metabolism
    Ecym_5013
   00640 Propanoate metabolism
    Ecym_5013
  Energy metabolism
   00680 Methane metabolism
    Ecym_5013
Enzymes [BR:erc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ecym_5013
Lipid biosynthesis proteins [BR:erc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ecym_5013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 11472900
NCBI-ProteinID: XP_003646633
UniProt: I6NCM4
Position
5:complement(22206..24371)
Genome map
AA seq 721 aa AA seqDB search
MVTTSGVEANGRDRGDAVGVGGLLQDGGSGSKMEVEAELNDGGRLPKEYEHLTSVDIVQQ
KSIVNRLSPRVAPHYKPHIASFEEYKKLYADSMDDPERFFGDHARNFIDWFRPFDQVFLA
GKDGLPSFDNNVWFINGQLNACYNMVDRHAMRDPDSVAIIYEADEPNQGCQLTYKELLEQ
VCKVAQVLQYSMGVRKGDTVAVYMPMIPQALITMLAISRIGAVHSVIFAGFSSNSLRDRI
NDANSQVVITTDESKRGGKTVETKRIVDDAVKEAPNVRHVLVYKRTNSPMVAYTSGRDLD
WDTEVKKYKPYCPCEPVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQAYLSMRYSFDVH
KEDIFFTAGDIGWITGHTYVIYGPLFTGCTTVVFEGTPAYPTFSRYWQIVDKYKVTQFYV
APTALRFLKRAGDSYVEGYSLKSLRSLGSVGEPIAAEVWEWYSSSIGKNEIPIIDTYWQT
ESGAHLITPLAGGSTPMKPGAAGFPFFGIDAVILDPNTGEELIGPNVEGILAVKRPWPSF
TRTIWNNHDRYLETYLKPYPGYYFTGDGAARDKDGFIWILGRVDDVVNVSGHRLSTAEIE
AAIIEEGMVAECAVVGFSDDLTGQAIAAFVVLEQKSSWATASERELQDIKRHLILIVRKD
IGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGEADQLGDVSTLSNPGIVKHLIESIK
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgacatcaggagtggaagcgaacggacgtgacaggggggatgctgtcggtgtt
gggggcttgctgcaggatggtggtagtggttcgaaaatggaggttgaggcggagctgaat
gatggcggacgcttgccaaaggagtacgagcatcttacgtctgtggatattgttcaacag
aagtctatagtgaatcggctttctccaagggtagcacctcactacaagccacacattgcg
agttttgaggagtataagaagttgtatgcggactctatggacgatccggagcggtttttt
ggtgaccatgcacgtaattttatcgattggttcaggcccttcgatcaagttttccttgcc
ggcaaggacgggttgccgtcgtttgacaataatgtctggttcattaacgggcagttgaat
gcgtgttacaacatggtcgacagacacgccatgagggatccggatagcgttgccatcatc
tatgaggccgatgaacctaaccagggttgtcagttgacgtacaaggagttgttggagcaa
gtttgtaaagttgcgcaagtcttgcagtattcgatgggtgtgcgcaagggcgatacagtg
gctgtttacatgcccatgatcccgcaagcgttgatcaccatgttggccatctcacgtatc
ggcgcagtgcattctgtcatctttgcaggcttctcgtccaactctttgagggaccgtatc
aatgatgccaactctcaggttgttattacgaccgatgaatccaagagaggcggaaagact
gttgaaaccaaacgtattgtggacgatgctgtcaaagaggcgcctaatgtcaggcatgtc
ttggtttataagcgtaccaacagcccaatggttgcttacactagtggtagagatttggac
tgggatacagaagttaaaaaatacaaaccatattgcccctgcgagcctgtggattctgaa
cacccgttattcttgttgtacacctccggctccacaggtgcccccaagggcgtccaacac
tccactgcgggatatttattacaggcatacttgagtatgcgttattcttttgatgttcac
aaggaagacatattcttcacggccggtgacatcggatggatcactggtcacacatatgtt
atctacggcccgttgtttactgggtgcaccacggtcgtgttcgaagggacccctgcttat
ccgacattctcgaggtattggcagattgtcgacaagtataaggtaacccagttttacgta
gcaccaacagccttgcggtttttgaaacgggctggtgacagctacgtcgaagggtattca
ttaaagagtttgcgttcattagggtctgttggggagccaattgctgctgaggtttgggaa
tggtattcgtccagtattggtaaaaatgaaatcccaataatagacacttattggcaaacg
gaatccggcgcgcatttgattaccccgttggctggtggctcgacaccgatgaaaccagga
gctgcaggcttccctttctttggaattgacgctgtaattctcgaccccaacaccggtgaa
gaattgattggacctaacgtcgagggtatattagctgtaaagcgaccatggccctctttc
acaaggaccatttggaacaaccacgatagatatttggaaacctatctaaagccttaccca
ggttattatttcaccggagatggtgcagctcgtgacaaagatggcttcatatggatcctt
gggcgtgtagacgatgtcgtaaacgtctctggtcatcgtctatccacagctgaaattgaa
gcggcaataattgaggaaggaatggtcgctgaatgtgccgttgtaggcttctctgacgat
ttaacaggacaagctatcgctgcctttgtggtattggaacagaaaagcagctgggctact
gcgagtgaaagggaattgcaagatatcaagagacacttgatattgatagtcagaaaggat
atcggtccatttgcagccccaaaattaatagtccttgtagacgacttgccaaaaactaga
tctgggaaaatcatgcgacgtatcttgaggaagattttggctggtgaagcagaccagttg
ggcgatgtctccaccttatctaacccaggtattgtgaagcatttaattgagtctatcaaa
ctatga

DBGET integrated database retrieval system