KEGG   Eremothecium cymbalariae: Ecym_5021Help
Entry
Ecym_5021         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
erc  Eremothecium cymbalariae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:erc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Ecym_5021
Translation factors [BR:erc03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Ecym_5021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:45999..48197
Genome map
AA seq 732 aa AA seqDB search
MATVFEDIRLEDISVDDVDLSELDREFDVENRIDFDNFVVVDGAPVAPEAKVPALSKVLT
KLFSQAGQVVDMDIPVEDGKTKGHLFLEFDSAVAAKKAIKLFNGKKLDVKHRLFVNSLND
MEKFGSPDFVTEFKEPKIPEPQPTEYLKSWLLDPKGRDQFVLQKSEMAAIFWYRNKLQPE
NIIDARKQWSDSILEFSPQGTYLFSFHTRGIASWGGAKFERLKRFSHPGVKAISVSPTEK
YLVTFSPEPLEVLEEPTEDFPFGPESNGHQLCIWDIATGMLMKTFPLPPNQQPQWPMVKW
SFDDQFCARLGPNAIAIYQTEKNFQLLNGKVMKIEGVQNFSFAPKGLKLASKRASDPLTT
AMVYWTPESNNQSCKAVIMELPTKRILRTINLVQVTDVDFHWQNEAKYLCVQVDHHTKSR
KTIFTNLEICRLTEREIPFEKVELKDRCMRFGWEPQGDRFVIISNSENINDNPAIPKNVV
GFYAPEKKDKGTEDKSLSDFKRWKLVHAVEGKFSNEIAWSPAGRFVCVAAIGKMISRSEN
LDFYDMDFPSEKIINTATDVNATLRDVAHVNYVNATDYQWDPSGRYIAFWSSAWKHKAEN
GYKVFNLCGNLIREELINDFNNFFWRPRPEPLLTNAEKKKVRKNLREWSTHFEELDAMEA
DSATRQLIIERRGWLEQWSKYRASTAENLATHNLSIYDVVNLAISEEDYEIIEEIKDSVV
DETTEEVTSFDQ
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagtttttgaggatatcaggttggaggacatatccgttgatgatgtggattta
tctgaacttgatcgtgaattcgatgttgagaataggattgattttgacaattttgttgta
gtggatggtgcacctgtggctcctgaggcgaaggttccagctttgagcaaggttttaacg
aagttatttagccaggcagggcaggtagtagatatggacattcctgttgaggatggaaag
actaaagggcatttgtttttggagtttgatagtgcggttgctgctaagaaggcgataaaa
ttgtttaacggtaagaaattggatgtgaaacatcgtttatttgttaacagtttgaatgac
atggaaaagtttggatctccagactttgtgaccgaattcaaagagccaaagattccggaa
cctcaaccaacagaatacttgaaatcatggttactggaccctaaaggcagagatcaattc
gtacttcagaaaagtgagatggctgctattttttggtacagaaacaagttgcagccagaa
aatatcattgatgccaggaaacaatggagtgattctattttggagttttctcctcaaggt
acttatttgttttccttccatacccgtggtattgcctcttggggtggtgcaaagtttgag
cgtttaaagagattttcacatcctggtgtgaaggcgatttctgtttctcctactgagaag
tatttggttaccttttctccagagcctttagaggtccttgaagagccgactgaggatttc
ccatttggcccagagtctaatgggcatcagttatgtatctgggacattgcgactggtatg
ttaatgaagactttccctctaccaccaaatcaacagccacaatggccaatggtcaaatgg
tcttttgatgaccagttctgtgctcgtttgggtccaaatgcaattgccatttatcaaact
gagaagaacttccagttgttaaacggcaaggttatgaagattgagggtgtgcaaaacttt
tcgtttgctccaaagggtttgaaattggcgtctaaaagagcttctgacccgttgacgacg
gcgatggtgtactggaccccagagtctaacaaccaatcttgtaaagcggtaataatggaa
ttgcctactaagaggattttaagaacgataaatttggttcaagtgactgatgtagatttc
cactggcaaaatgaggcgaaatacttgtgtgtgcaagttgaccatcacaccaaatccaga
aagacgatttttacaaacttggaaatttgtaggttgacagagcgtgaaattccatttgaa
aaagttgaactcaaggatcgctgtatgagattcggttgggaaccccagggcgacagattt
gttattatttcaaattcagagaatattaatgacaatccagccattccaaagaatgtagtc
ggtttctatgctcctgaaaagaaggacaagggcacagaagacaaatcgttatctgacttt
aagagatggaagttggtgcatgcggttgaaggcaagttctccaacgaaattgcttggtct
ccagctggtagatttgtttgtgttgctgctattggtaaaatgatctcacgtagtgaaaac
ctggatttctacgacatggatttccctagcgagaagattattaatacagctaccgatgtt
aacgctactttgagagacgtcgcacatgtgaactacgttaatgcaactgactaccagtgg
gacccaagcggtaggtatattgctttttggtcgtctgcctggaagcataaggctgaaaat
ggctacaaagtctttaatctatgtggaaacctgattcgggaagaattgataaatgatttt
aataatttcttctggagaccaagacctgagccattgttgactaatgctgaaaagaaaaag
gttagaaagaacttgagagaatggtctactcattttgaagaattagatgccatggaggcg
gacagtgcaacgagacagttgatcattgagagacgtggctggttagaacaatggtcgaag
tacagagcttctactgcagaaaacttggccactcataatttgtctatttatgacgttgta
aacttagcaatcagtgaggaagattatgaaattatcgaggagatcaaagactccgttgta
gatgagacaactgaagaagttacctcatttgaccagtga

DBGET integrated database retrieval system