KEGG   Eremothecium cymbalariae: Ecym_5236Help
Entry
Ecym_5236         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:erc04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:486270..488864
Genome map
AA seq 864 aa AA seqDB search
MQDSVTSHQYLHPVSNYNNGNIGSVNNIMRRSQGDIIDSDDENPLSPPKLSNFGSALFTD
KENETPTYLRKSGVVAQPAPYPNINMNANKPPTLTGTLHMDDGSHSTLFTSVSKHQPSMT
TVNQEQRTPGEEGLGSYRFQMIQQSMKDELSSRQIMRRSRRFITSRLSTLGPAKRNTTLT
ANLDFSSNMSHEDSRDLSHQDGNISSSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGL
KSASSIDYDNISFGDLNPYQYLKKHNLPTSELPNISRIYFEIQKKENRRAAVRKNIFTNN
SINSSSTAKDYGGDNKHNNKHNNNNNNNNNNNNNNNKSNNNNNDSVNNNNIGNIHLNISN
RNGNQNHNTHGNTMGTNKWTPTQTLSVPKRDRQPRRKTSDASVSSFSKILSSPITGAANN
YVESQKQIQPPMQRSPVSLGPLQLNPNTKKREALNKLDVNSTNQQAIVHKKHKSDEQNFY
HIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQIIQVNGSEYEKV
ELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRLEDQTRVVKLI
DHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQVVHDTGIVHSD
LKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTPDQGQT
EQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTT
HGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLIKNAVKYGSDQ
RYVSKEKVEDLADDVWNRLSDFRL
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattcggtcacatcacatcaataccttcaccccgtgagcaactataataatggc
aacattggaagcgttaacaacataatgaggagatcacaaggagacatcattgattcggac
gatgagaatccgctgagtcctcctaaattaagcaattttggttcggcattatttacagat
aaggagaacgagacgccaacataccttagaaaatctggtgtggttgcgcagccagcacct
tatccgaacataaatatgaatgccaacaaaccacctacgctgacgggtaccctgcacatg
gatgatggttcacattcaacgttgtttacatctgtatcaaaacaccagccgagtatgaca
actgtgaatcaagagcaacggactcccggggaagagggattgggttcgtatagatttcaa
atgatacagcaatctatgaaggatgagctttcatctagacaaataatgagacgaagtagg
cgatttattacttctcgtctttcgaccctagggccagctaaaagaaatacaacattgact
gcgaacctcgacttttcttctaatatgagccatgaagactcgcgtgatttatcacatcag
gatggcaacatatcatcttcatcgaacaaccacagtgggctactacaaaaccaagattat
aatgtgttcctagatacagaacccaactgtagaccggatagcaaagaaaatgatgggtta
aagagcgctagctcgattgactatgacaacatatcctttggggatttgaatccttatcaa
tacttgaaaaagcacaatttaccaacaagcgaacttccaaatatttctcgaatttatttt
gaaatacaaaagaaggagaatagacgggctgcagtgaggaagaatatttttaccaacaat
agcatcaacagcagcagtacagccaaggactatggcggcgacaacaaacacaacaacaaa
cataacaacaacaacaacaacaacaacaacaacaacaacaacaacaacaaaagcaacaac
aataataatgactctgttaataataataacataggtaacatacaccttaatattagcaat
aggaacggtaatcaaaaccataatactcacggtaatacgatgggcaccaataagtggact
cccacccaaacattgagtgttccaaagagggatagacagcctagacggaagaccagcgat
gcatccgtgagttctttttcgaagatactgtcgtctcctatcactggtgcagccaacaac
tacgttgaatcacaaaagcaaatacaaccgcctatgcaaagaagtcctgtttctctgggt
ccccttcagctcaatccgaataccaaaaagcgagaggcgctgaataaactggatgttaac
tcaaccaatcaacaggctatagtccataaaaaacataagtcagatgaacagaacttttat
catattagaaaggctccgaatcctcctgcagtaaaaaaagtagagattattgaaccagtt
aaagataccgtaattactacaattccgttaaaaccgccatctacagaaaatggaagttat
caaacacctcagaggaaaagacagattatccaagttaatggttcagagtatgaaaaagta
gagcttctaggccgaggtggatcctcaaaagtgtacaaagtgcgtagttcgaataacaag
atatatgcattgaagagggtgtcttttgatgagtttgatgataccagtatagatgggttt
aagggtgaaattgagttattaaaaaggttagaagatcaaacccgtgttgtaaagttgata
gaccatgaaatgaatcacggtgtgctatatgttgttatggaatgcggtgatcatgatctt
tctcaagttttagctcaaagggcaaatatgccttttgacatcgaattcgtgcgttaccat
gcccaagaaatgctaaaatgtgtgcaagtggttcacgatacagggatagttcattcagac
ttaaagcctgctaattttgtttttgtgaaaggtattctaaagattatagactttggtatt
gcaaacgctgtccctgatcataccgttaacatatatcgtgatacccaaattggcacacca
aattacatggctccggaagccttggttgccatgaattatactccagaccaaggccaaacg
gaacaagaaatacaacaaaacaggtggaaggttggtaaaccatcggatatttggtcttgt
ggatgcataatatatcaaatgatttatggaaggcccccatatggtgggtttcaaggccaa
aacaggttgttagcaattatgaatccagaagttaaaatagtttaccctgaaaaaacaacg
catggtgatcttgttccacgcactgcactggataccattaaagcttgtttggaaagaaac
ccggaaagaagatggacagtagatgatctactaagaggtccattcattaaacctgtatct
gtgacgcacttctttattcgtgatttgattaaaaacgctgttaagtatggttctgaccaa
aggtatgtatctaaagagaaagtggaagatttggcagatgatgtttggaacaggttaagt
gattttagattgtaa

DBGET integrated database retrieval system