KEGG   Eremothecium cymbalariae: Ecym_5295Help
Entry
Ecym_5295         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
erc  Eremothecium cymbalariae
Brite
Chromosome and associated proteins [BR:erc03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Ecym_5295
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ecym_5295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W YscO-like
Motif
Other DBs
NCBI-GeneID: 11468384
NCBI-ProteinID: XP_003646874
UniProt: I6NDB5
Position
5:598478..598861
Genome map
AA seq 127 aa AA seqDB search
MAPKAEKKPASKAPAAKKTTTSADVSKKRTKTRKETYSSYIYKVLKQTHPDTGISQKSMS
ILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTK
YSSSTQA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggctgaaaagaaacctgcttccaaggcaccagctgctaagaaaaccaca
acgtccgctgatgtttccaagaagaggaccaagaccagaaaggagacttactcttcttat
atttacaaggttttgaagcaaacacatccagatactggtatttctcaaaagtctatgtct
attttgaattcatttgtcaatgatatctttgagagaatcgcttctgaagcttccaaattg
gctgcttataacaagaagtctactatttctgctagagaaatccaaacggctgttagattg
attttgccaggtgaattagcaaagcatgctgtatctgaaggtactagagctgttaccaag
tattcttcttctactcaagcttga

DBGET integrated database retrieval system