KEGG   Eremothecium cymbalariae: Ecym_5295Help
Entry
Ecym_5295         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
erc  Eremothecium cymbalariae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:598478..598861
Genome map
AA seq 127 aa AA seqDB search
MAPKAEKKPASKAPAAKKTTTSADVSKKRTKTRKETYSSYIYKVLKQTHPDTGISQKSMS
ILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTK
YSSSTQA
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggctgaaaagaaacctgcttccaaggcaccagctgctaagaaaaccaca
acgtccgctgatgtttccaagaagaggaccaagaccagaaaggagacttactcttcttat
atttacaaggttttgaagcaaacacatccagatactggtatttctcaaaagtctatgtct
attttgaattcatttgtcaatgatatctttgagagaatcgcttctgaagcttccaaattg
gctgcttataacaagaagtctactatttctgctagagaaatccaaacggctgttagattg
attttgccaggtgaattagcaaagcatgctgtatctgaaggtactagagctgttaccaag
tattcttcttctactcaagcttga

DBGET integrated database retrieval system