KEGG   Eremothecium cymbalariae: Ecym_5429Help
Entry
Ecym_5429         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
erc  Eremothecium cymbalariae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecym_5429
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ecym_5429
   00630 Glyoxylate and dicarboxylate metabolism
    Ecym_5429
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ecym_5429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5:complement(884168..885835)
Genome map
AA seq 555 aa AA seqDB search
MVSISLERVRVLVDIDSEPRFRPSTTTASDILTKEALEFVALLHRTFNGRRKELLVNRRR
VQAMLDSGEYRFEFLPETKWIREDPTWQGPVLAPGLVNRSTEITGPPVRNMLVNALNSPV
NTYMTDFEDSLAPTWENISQGQVNLYDAVRDKLGFVTSQKAYKLNGKISELPTIIVRPRG
WHMEDKHISVDDEPISASLLDFGLYFFHNAYKLVDIGKGPYFYLPKMEHHMEAKLWNDVF
NVAQDYIGMTRGTIRATVLIETLPAAFQMEEIIWQLRQHSSGLNCGRWDYIFSTIKKLRN
QSDHVLPDRDQVTMTSPFMDAYVKRLISTCHRRGVHAMGGMAAQIPIKGDAAANEAALAK
VRNDKIRELKNGHDGSWVAHPALAPICNSVFKDMGTPNQIHYIPEVDVTAFDLVNTSISG
ARITVAGIKQNLDIGLQYMEAWLRGSGCVPINNLMEDAATAEVSRCQLHQWVKHKVRLSD
TGEQVTPSLMRKLLKERADYLARSSPAGSSNKFATAAAYLEPEITGERFSDFLTTLLYDE
IVTTKSNSYGNSSRL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgattagtttagagagagtgagggtgttggtggatatagattctgagccgagg
ttcagaccttctactacgacggcgagtgatattttgacgaaggaggctttggagtttgtt
gctttattacatcggacttttaatgggcgtcggaaggagttgcttgtgaatcggcggcgg
gtgcaggcgatgttggatagcggggagtataggtttgagtttctgcctgagacgaagtgg
atccgggaggatcctacttggcaggggccggtgctggcgcctgggttggtgaaccggtct
acggagattacggggccaccggtcaggaatatgttggttaatgctttgaattcgcctgtg
aacacttacatgacggattttgaggattcgctggcgccaacatgggagaatatcagtcag
gggcaagtgaatttgtacgatgcggtcagggataagcttgggttcgtgacgtcgcagaag
gcatataagttgaacgggaagatttctgagttgcctactataattgttcggcctcgtggg
tggcatatggaggataagcatatttcggttgatgatgagcctattagtgcgtctttgttg
gatttcggattatattttttccacaatgcctacaagttggtagatattgggaaggggcct
tacttttatttgcccaagatggagcatcatatggaggccaagctctggaatgatgttttt
aatgtggcccaggattacattgggatgactcggggtacaattagagctacggtgttgatt
gagacgttgcctgcggcgttccagatggaggaaatcatctggcagttgagacagcattct
tcggggttgaattgtgggcgttgggattatattttcagcactattaagaagttacgcaat
caatcggaccatgtgttgcctgacagggaccaggtgacgatgacttccccttttatggat
gcgtatgtgaagagattgatatccacctgtcacaggcgcggtgtgcatgctatgggcggt
atggctgcgcaaatccccatcaaaggcgacgccgccgctaacgaggcggccttggccaaa
gtccgtaacgataagatcagagaacttaaaaacgggcatgatggctcctgggtcgcgcac
cctgctctagcgccaatctgcaacagtgtgttcaaggatatgggcacgccaaaccagatc
cactacatcccagaggttgatgtcacggcgttcgacttggtcaatacctcgatttctggt
gccagaattacggttgccggtatcaaacagaaccttgacattggtttgcaatacatggag
gcctggttacgtggaagcggctgtgtgccaatcaataacctgatggaggatgcggccaca
gctgaagtttcgcgttgtcagttgcatcaatgggtcaaacacaaggtaagactctctgat
actggtgaacaggtcacgccttccctaatgcgtaagctactaaaagagcgcgcagactac
ttggcacgttctagccctgcaggttccagcaacaagtttgcgaccgcagctgcctacttg
gagcctgagattacgggtgaaaggttctcagacttcttgactaccctgctgtatgacgaa
atcgtcaccaccaagtcgaattcctacggcaacagcagcagactctga

DBGET integrated database retrieval system