KEGG   Eremothecium cymbalariae: Ecym_6077Help
Entry
Ecym_6077         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ecym_6077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:147377..148315
Genome map
AA seq 312 aa AA seqDB search
MKTTNNDEIGDLYGILEKPNIREVQFGLDKRFRTWYGITVYFANDRKSLGYKFKHSGTSE
RNPEPNGDYFWLDTLLVCEYCFKYYDETDEFIAHERCCRYKRRPPGRIKYLSPEYSIRKV
KGTKHELFCQCLCLFTKLFLDNKSVYFRMTGYEFYILYETNSNKPLGFFSKDQYSYNRNN
LACILVFPPYQRRNLGTLLIDFSYRLSKNDGIISGPELPLSPFGLIGYLKFWSFSIAWHI
TEGDLSDRHKISLNTISEVTGIRVADVLTVLKHMQCLTENDEILLPVVRRWAKDHNVERG
FMLKEQYLVLND
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccactaataatgatgaaataggagatctttatgggattttagagaaaccaaat
atcagggaggtgcaatttggtctggacaagagatttaggacttggtatggtattactgtt
tactttgctaatgacagaaagtctttaggttacaagttcaaacattcagggaccagtgaa
agaaatcctgagccgaatggcgactacttttggctagatacattgcttgtttgcgagtac
tgctttaaatactatgacgaaacggacgaattcatcgcgcacgaacgatgttgtcggtat
aaaaggcgaccgcctggtagaatcaaatacttaagccctgagtattcaattaggaaagtg
aagggcacaaaacatgagttgttctgtcaatgtttgtgtttgttcacaaagttgttcttg
gataataaatcagtctattttcgaatgacgggatacgagttttacattctatatgagact
aactcgaataaaccattgggatttttctccaaagaccagtattcttataatagaaataat
ttggcgtgcattctggttttcccgccataccaaagacgtaatttagggaccttgttaatc
gatttctcgtacagattgtctaagaatgatggaattatatcgggtccagaacttccactt
tccccatttggattaattggctatctaaagttctggtcattttcaattgcttggcatatc
accgaaggagacctttctgataggcataagatttctttgaatactatttcagaagttact
ggcatcagagttgccgatgttctcacggtgttgaagcacatgcaatgtctaaccgaaaat
gatgaaattcttttgcccgtggtcagaagatgggcaaaagatcacaatgttgaaagggga
tttatgctcaaagagcagtacttggtgcttaatgattag

DBGET integrated database retrieval system