KEGG   Eremothecium cymbalariae: Ecym_6145Help
Entry
Ecym_6145         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
Organism
erc  Eremothecium cymbalariae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(266766..267863)
Genome map
AA seq 365 aa AA seqDB search
MPRTITFDIPSRYKLVDLIGEGAYGTVCSAIHKPTGTKVAIKKIQPFTRAMFVTRTLREL
KLLKFFHSHENIISVLDIVRPTSYQEFDAVYLVQELMETDLQRIISQTNNFLSDDHIQYF
TYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMT
EYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWVILEILG
TPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINPLAMDLLDKMLTFNPDKRIS
AEEALKHPYLETYHDANDEPDYELLNLQDDFWKVDNEARQKTEEEELPLDTLKMMLHKEV
MKPLQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggactataacctttgatataccatcacgttataaacttgtggatctcattggc
gaaggtgcgtatggcaccgtatgctctgctatccacaagccaacaggtacgaaggttgcc
attaagaagattcagccatttactagggctatgtttgtgacgaggaccctaagggaactg
aagctcttaaaattcttccatagccatgaaaatattatctcagtacttgacatagtacgt
cctacatcttatcaagagtttgatgcggtttatcttgtgcaagaactcatggaaactgat
ttgcaacgaatcatatctcaaacgaacaatttcctatctgacgaccacatccagtacttt
acctaccagattctgcgtgcgttaaagtcattgcattctgcacaagtgatacaccgtgac
ttaaagccttcgaaccttcttttaaattccagctgtgacttgaagctgtgcgattttggc
ctttcccgttgccttgcttcaagtgaccgttctagggagaatatggttgggttcatgacg
gagtacgttgccacaaggtggtacagagctcctgaaatcatgctctcatttcaagaatat
accacggctatggatatttggtcctgcggatgtattctcgcagaaatgattagtggtaaa
ccgttattccccggtagagattaccatcatcagctgtgggttatcctagagattttaggc
accccatcttatgaagattttgcacagatcaaaagcaaaagagcaaaagcttatatttta
aatttgcccatgaggctaaagatcccatggaacgtagcattgggcacaaacgacattaac
cctcttgctatggatttactggataaaatgctgacctttaacccggacaagaggataagt
gcagaagaggcgttgaagcatccttaccttgaaacataccatgatgcaaacgatgaacca
gactatgaactactaaacctgcaagatgatttctggaaagttgacaatgaagcaagacaa
aagacggaagaagaagaactacctttagatacactcaaaatgatgcttcataaagaagtc
atgaaaccgttgcaatga

DBGET integrated database retrieval system