KEGG   Eremothecium cymbalariae: Ecym_6145Help
Entry
Ecym_6145         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Ecym_6145
Protein kinases [BR:erc01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Ecym_6145
Exosome [BR:erc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Ecym_6145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(266766..267863)
Genome map
AA seq 365 aa AA seqDB search
MPRTITFDIPSRYKLVDLIGEGAYGTVCSAIHKPTGTKVAIKKIQPFTRAMFVTRTLREL
KLLKFFHSHENIISVLDIVRPTSYQEFDAVYLVQELMETDLQRIISQTNNFLSDDHIQYF
TYQILRALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMT
EYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQLWVILEILG
TPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINPLAMDLLDKMLTFNPDKRIS
AEEALKHPYLETYHDANDEPDYELLNLQDDFWKVDNEARQKTEEEELPLDTLKMMLHKEV
MKPLQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcccaggactataacctttgatataccatcacgttataaacttgtggatctcattggc
gaaggtgcgtatggcaccgtatgctctgctatccacaagccaacaggtacgaaggttgcc
attaagaagattcagccatttactagggctatgtttgtgacgaggaccctaagggaactg
aagctcttaaaattcttccatagccatgaaaatattatctcagtacttgacatagtacgt
cctacatcttatcaagagtttgatgcggtttatcttgtgcaagaactcatggaaactgat
ttgcaacgaatcatatctcaaacgaacaatttcctatctgacgaccacatccagtacttt
acctaccagattctgcgtgcgttaaagtcattgcattctgcacaagtgatacaccgtgac
ttaaagccttcgaaccttcttttaaattccagctgtgacttgaagctgtgcgattttggc
ctttcccgttgccttgcttcaagtgaccgttctagggagaatatggttgggttcatgacg
gagtacgttgccacaaggtggtacagagctcctgaaatcatgctctcatttcaagaatat
accacggctatggatatttggtcctgcggatgtattctcgcagaaatgattagtggtaaa
ccgttattccccggtagagattaccatcatcagctgtgggttatcctagagattttaggc
accccatcttatgaagattttgcacagatcaaaagcaaaagagcaaaagcttatatttta
aatttgcccatgaggctaaagatcccatggaacgtagcattgggcacaaacgacattaac
cctcttgctatggatttactggataaaatgctgacctttaacccggacaagaggataagt
gcagaagaggcgttgaagcatccttaccttgaaacataccatgatgcaaacgatgaacca
gactatgaactactaaacctgcaagatgatttctggaaagttgacaatgaagcaagacaa
aagacggaagaagaagaactacctttagatacactcaaaatgatgcttcataaagaagtc
atgaaaccgttgcaatga

DBGET integrated database retrieval system