KEGG   Eremothecium cymbalariae: Ecym_6184Help
Entry
Ecym_6184         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
erc  Eremothecium cymbalariae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:erc04144]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:341652..344207
Genome map
AA seq 851 aa AA seqDB search
MPHIEETHIWCRPMSQLSHLAEQFVTENGTDASDMKLLLQQCIDTLSNYQEECKKIKGMR
GNVMTKEVYDSYETAYVYFKIVSLIVLNKIPKLEEYGRAKSDLNQNGKELLEIYNMLVNR
LIKDEKISEIKKFVRGHSKQDSNMTNDFAPFDVENGSSISSLMLHNLITTPATATSVLLI
DIRPRVDFVNFHIKFESLICIEPVSFKDSHSDIDIAKKSMITSPDNEIALFQERDKFEYI
ILYTQGSEKNDYNIHQQEVLVDLLINRSFQKSLYNTKILTLDGGFSSWSTAYPNLCESFQ
GDSVYINGDTSSLSLQSMPQAAPQNKYNPIFQSMFSKNGEANDITRSPLHFPLQQQSKLK
RTPSFKDYFKGSNSTLTLNERPGSVPPQFQNGFANYPETPKLISSNEYMKSLPQISPITS
KALTTASRGLSAVGGSKSSPQSNTSNLLNPSASPLKRNENSVGFSSMKSPGQEWAMLTAF
NLNFSVGLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHINLNSRLGSKGVLARYFS
QLIHQMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFRDRSQQDCQEFCQFLLDGLH
EDLNQCGNNPPLKELSEKAEKMREMMPMRIASSIEWERYLTTDFSVIVDLFQGQYASQLR
CKVCGRTSTTYQPFSVLSVPVPSSRQCTIIDCFTEFTKVETLDLDEQWSCPDCKKRQPST
KKITITRLPRNLIIHLKRFDNMLNKNNVFVSYSAVLNLTSFWANDYDKKVMNNNNVELPS
RGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKGATLGWCYYDDTNWRQIRSSNEYISQNA
YVLFYHRIHGS
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgccacatattgaagaaacacatatttggtgtcgacccatgagtcagctatcgcatctt
gcagaacagtttgtcacagagaatggaactgatgccagtgatatgaaattgctcttacag
cagtgtatcgacactttatcaaattatcaggaggaatgcaagaagattaagggaatgcgt
ggcaatgtaatgactaaggaagtatatgattcatatgagactgcgtacgtgtacttcaag
attgtttcgctgatagtgttgaataaaatccctaagcttgaagagtatgggcgtgctaaa
agcgatctaaatcaaaatggcaaagagctgttagagatttataatatgttagtcaatcgt
ttaatcaaagacgagaagatctctgagataaagaaatttgttagagggcattccaaacag
gatagtaatatgacaaatgattttgcaccttttgatgtggaaaatggctcatcaatttcc
agtctgatgttgcataacttaattactacacctgctactgcaacgtcggtcttgctaatt
gatatccggccacgagtagattttgttaattttcatatcaagtttgaatctttgatctgc
attgagccagtttcatttaaggatagtcattcagacatagatattgccaaaaaatctatg
atcactagtccagacaacgaaatagcgctattccaagaaagagataagtttgaatacatt
attttatacacccaaggaagtgagaaaaacgactacaatattcatcaacaagaagtatta
gtagacttgttgattaaccggtcttttcaaaagtcactatataatactaaaattttgaca
ctagacggcggattttctagctggtctacggcatatcccaatctatgtgaatctttccag
ggtgatagtgtttacatcaatggtgatacgtcgagtttgagtttacagtcaatgccacag
gctgcacctcaaaataaatacaatcctattttccaatcaatgttctccaagaatggtgaa
gcgaacgatattactaggagtccccttcattttccgcttcaacaacagtcaaaattaaaa
cgaacaccaagttttaaagactattttaaggggtcaaattcgactttaactttaaatgag
agacctggtagcgttccgccacagtttcaaaatggctttgcaaattatccagaaactcca
aaattgataagcagtaatgaatacatgaaatctttacctcagatatctccaattacatcg
aaagcactaacaactgcatctcgtggactttcggctgttggtggatctaaaagctctcct
caaagtaatacatcgaatttactaaacccaagtgcatctccattaaaacgaaatgaaaat
agtgtgggatttagttcaatgaaatctccgggacaagaatgggcaatgttaaccgctttc
aatttaaattttagtgtgggacttgtgaattgtggtaattcatgctatatgagctgcatt
atacagtgcttgcttggcactcaggagttatgcacaatgtttttaaacaattcttatcaa
aaccatataaatttgaacagcaggctagggtctaagggtgttttagcaagatatttctct
cagctaatccatcaaatgtatcaacaggggaaagacatacgtaaaacttcaggcaccgaa
aaaacagcagttctacctgcccaatttaagattgcttgtgggtcaataaacgctctcttt
agagataggtcacagcaagattgtcaagaattttgccaatttctcttggatggtctacat
gaagacttaaaccaatgtgggaacaaccctccattaaaggaactatcagaaaaggcagag
aagatgagggaaatgatgcccatgcgaattgcatcctcaattgaatgggagaggtactta
accactgactttagtgtgatagttgatttattccaaggtcagtatgcttcacaattacga
tgtaaagtatgcggcaggacatccacaacctatcagcccttctccgtgctctcggtacca
gtccccagttcaagacagtgtactattattgactgctttacagaatttaccaaagttgaa
acgcttgatcttgatgaacaatggtcatgtcccgattgcaagaaaaggcagccatccaca
aagaagatcacaataacaaggcttcccagaaatttaatcattcacctcaaaagatttgac
aatatgttaaataagaacaatgtgtttgtttcttattctgcagtgctgaatttaacatct
ttttgggctaatgattatgacaagaaagttatgaacaataacaacgttgaactaccttcg
cggggtcaagttcccccattcaattatcagctttacggggtagcttgccacacaggtaca
ctatatggtggtcattatacagcttatgttaataaaggtgctacattaggttggtgctat
tatgacgacaccaactggaggcaaattaggagttccaacgaatacatttcacagaacgca
tacgtattattttatcaccgcattcatggttcatga

DBGET integrated database retrieval system