KEGG   Eremothecium cymbalariae: Ecym_6248Help
Entry
Ecym_6248         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
erc  Eremothecium cymbalariae
Brite
Enzymes [BR:erc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Ecym_6248
Peptidases [BR:erc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Ecym_6248
Transcription machinery [BR:erc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Ecym_6248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:468203..469603
Genome map
AA seq 466 aa AA seqDB search
MVCQHMEQVIQTAKVGEAVVKECITVRYLIRNCDAKDRYLKAMRCSECFQINCGNTFMCL
QCGFVGCWNENHFLHHSKKVGHIFGVNATNGLLFCFRCCDYIGDNELVRMDIMPKYWDEV
LLRSSIPSVDGKDGLLGLVNMGSTCFMSSVIQTLVHIPHVLQHVLKQTHQSTCDIQDSIA
CVSCAVDEIVANLYGYPKPNAVTKSSVGQYSHISSTFSRQQKGFIDLLTCSWKINKNLAG
YTQQDAHEFWQFLLNQLHSDHVRAHKPSSNNSNCECILHLLFQGYLESNIACSECHTNSK
TTVDPIMDLSLGIQNKSTLHECLNSFHKREPLTDFNYCCKKCKSTKNPIRQLTTAKLPPV
LMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPVDCLHPVPNMMYKLSAIISHHGT
VHQGHYTTICRINGDIWAKFNDSMVTVISEEDMLKEQAYLLYYVIC
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgccagcatatggagcaggtaatccagacggcaaaggtaggcgaggcggttgtg
aaagaatgtattactgtgcgttacctgatcagaaactgtgatgctaaagaccgatatctt
aaagcaatgagatgctctgaatgttttcagatcaattgtgggaatacgtttatgtgtctt
cagtgtgggtttgtaggatgttggaacgaaaaccacttcttacatcatagcaaaaaagtg
gggcacatatttggagtgaatgctactaatggtctcttattttgttttcgttgctgtgat
tacattggcgataatgaattggttcgaatggatatcatgcctaagtactgggatgaggtt
ttgttacgaagttcgattccaagtgtggatggcaaagacgggttgcttggcttggtgaac
atggggtctacttgttttatgagtagtgtaatacagacgctagtgcatattccacatgtt
ttgcaacatgtgctgaagcagacccatcaatcgacgtgtgatatccaggacagtatcgcc
tgtgtatcctgtgctgttgacgaaatagtggcaaacttatacgggtatccgaaacctaat
gccgttactaagagctcagtcgggcaatattcacatatatcaagtactttttcaaggcag
cagaaggggtttattgatttattgacatgctcttggaaaataaataagaatttggcaggt
tacacgcagcaagatgcacatgaattctggcagttcttactgaaccagttgcattcagac
cacgtgagagcacacaaaccttcatcaaataattctaattgtgaatgtatccttcatttg
ctttttcagggctacttggagtctaatatcgcttgctctgaatgtcatacgaacagcaaa
accacggttgatccgataatggatttatctctgggaatccaaaataaatctacattacat
gaatgtttaaattcctttcataaaagggagccactgaccgattttaattactgctgtaag
aaatgcaaatcgaccaagaatccaataagacagttgacgacggctaaattaccgcctgtg
ctaatgctacaactaaagaggtttgaacacttaatgaacggtactagtgtcaaaataaat
gattacatatcgtttccattgcatttgaatatgaaagactactgtaaaccagtagattgt
ctgcatcccgtccctaatatgatgtataagttgtctgctattatttcacaccacggtacc
gtccatcaaggacattatacgacaatttgtaggataaacggggatatatgggctaaattc
aatgactcgatggtcactgtaatatctgaagaagatatgttaaaagagcaagcatatttg
ctgtattacgttatttgctaa

DBGET integrated database retrieval system