KEGG   Eremothecium cymbalariae: Ecym_6256Help
Entry
Ecym_6256         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:erc04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6:complement(477630..478577)
Genome map
AA seq 315 aa AA seqDB search
MRLFGSILVGVAIIVQWINAENLYDGSPHIVELTPKNFEKVVDLTNYTSVVEFYAPWCGY
CQRLQGTFKKVAKALDGVVQVAAVNCDEAKNKRLCAKHRIQGFPTLMVFRPPKVDVNKPG
SVTKRSMRHGMEVYSGAQEVKPLVNFAVSRIKNYVTKWMHIGKLGDVVQNTDSSIRYAAL
LISKRDMISPVYKSIAIDWLGKIEFYYISHARLAGAKSFELPSHPNIEAFVRGLITADHE
ESKLVLFDKEKDELHVFGEGAIKKLNVATFLSQFETPQEGPLSKREDFLNSLKTGSKKTS
SKKHKKQQELDHDEL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcggttatttgggtctattttggtcggtgttgctattattgtccagtggataaatgcc
gaaaacttgtacgatggttctccacatattgttgaattgacaccgaagaattttgaaaag
gtagtggacctaactaactataccagtgtggttgagttctatgctccatggtgtgggtac
tgccaacgattgcaggggacctttaagaaggtagcgaaggctttggatggtgttgtgcag
gttgctgcggtgaattgtgatgaagctaagaacaagcggctttgtgccaagcatcggata
caaggattcccaacattgatggtgttcaggcctcctaaggtagatgtgaataagcctggg
agtgtgaccaagcggtctatgcggcatgggatggaggtttactcgggagcacaggaggtg
aaaccgttggtgaactttgcggtttctcggatcaagaactatgttaccaaatggatgcat
atcggcaagttgggcgatgttgttcagaacactgacagcagtattagatatgctgcgttg
cttatttcgaagagggatatgatttccccagtgtacaagagtattgctattgactggttg
ggcaaaattgagttctattacattagccatgctaggttggcaggcgctaagtcgtttgaa
ttaccatctcatccgaacatcgaagcattcgtgcggggtttgatcacagccgatcatgaa
gagagtaaactagtattgtttgataaagaaaaggatgaactccatgtgttcggtgaggga
gcaattaaaaaattgaatgtggctacattcttatcacaatttgagactccacaagaaggc
ccactctcgaagagagaagattttttgaattccttaaagacaggctcaaaaaagacgtcc
tccaagaaacataagaaacagcaagaattagatcatgatgaactgtag

DBGET integrated database retrieval system