KEGG   Eremothecium cymbalariae: Ecym_7012Help
Entry
Ecym_7012         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
erc  Eremothecium cymbalariae
Brite
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Ecym_7012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 11472395
NCBI-ProteinID: XP_003647686
UniProt: G8JVK4
Position
7:complement(join(21922..22397,22466..22517))
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKLLEDLLDDTNFDRDEIERLRKRFMKLDRDSSGSIDKSEFMSIPGVSSNPLAGR
IMEVFDADNSGGIDFQEFISSLSIFSGRSDKEDKLKFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLEDDQLQQIVDRTIMENDVDGDGRLSFEEFKNAVETTEVANSLTLQCDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagcaccttctaagctcttagaagatttgctcgacgacaccaactttgacaga
gatgaaattgaaagactgcggaagagattcatgaaattggatcgagatagctcgggctcg
attgataagagtgagtttatgtcgatcccaggagtttcttctaatccactagcaggaagg
attatggaggtatttgatgctgataatagtggtggtattgatttccaagaatttattagc
agtttgtctattttcagtggtagaagtgacaaggaggataagctgaagtttgcctttaaa
atttatgacatagataaggacggttatatctctaatggtgaattattcattgttttaaag
attatggtaggtaataatcttgaagacgatcagttgcaacaaattgtagacagaacaatt
atggagaatgatgttgatggtgatggaaggctaagctttgaagaattcaagaatgcagta
gaaactactgaagttgcaaattcattgacattgcaatgtgatatataa

DBGET integrated database retrieval system