KEGG   Eremothecium cymbalariae: Ecym_7012Help
Entry
Ecym_7012         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
erc  Eremothecium cymbalariae
Brite
Protein phosphatases and associated proteins [BR:erc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Ecym_7012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(join(21922..22397,22466..22517))
Genome map
AA seq 175 aa AA seqDB search
MGAAPSKLLEDLLDDTNFDRDEIERLRKRFMKLDRDSSGSIDKSEFMSIPGVSSNPLAGR
IMEVFDADNSGGIDFQEFISSLSIFSGRSDKEDKLKFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLEDDQLQQIVDRTIMENDVDGDGRLSFEEFKNAVETTEVANSLTLQCDI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggagcagcaccttctaagctcttagaagatttgctcgacgacaccaactttgacaga
gatgaaattgaaagactgcggaagagattcatgaaattggatcgagatagctcgggctcg
attgataagagtgagtttatgtcgatcccaggagtttcttctaatccactagcaggaagg
attatggaggtatttgatgctgataatagtggtggtattgatttccaagaatttattagc
agtttgtctattttcagtggtagaagtgacaaggaggataagctgaagtttgcctttaaa
atttatgacatagataaggacggttatatctctaatggtgaattattcattgttttaaag
attatggtaggtaataatcttgaagacgatcagttgcaacaaattgtagacagaacaatt
atggagaatgatgttgatggtgatggaaggctaagctttgaagaattcaagaatgcagta
gaaactactgaagttgcaaattcattgacattgcaatgtgatatataa

DBGET integrated database retrieval system