KEGG   Eremothecium cymbalariae: Ecym_7096Help
Entry
Ecym_7096         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ecym_7096
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Ecym_7096
Enzymes [BR:erc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Ecym_7096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(186879..187847)
Genome map
AA seq 322 aa AA seqDB search
MTGTAGKPNYKFFETKKATIVLAPFSGGQGKSGVEDGPKYLMKQGLQHGLESVGWQVDVK
KPLEGRDFEQRKISSPEVDGKVKNPTIVGEATQLIYGAVKSAAHEGRLPVTLGGDHSIAI
GTVSGVLDKYPDAGLLWIDAHADINTLASTDSGNLHGCPVSFLMNMERDSWPESLKWVPG
TLKPNKIAYIGLRDVDPEEKIILKNLGIAAFSMYHVDRYGINAVIEMALKAVSPDGKGPI
MVSYDVDAIDPMYVPATGTPVRGGLTLREGLFIVERIAETGNLVALDVVECNPGLASHDL
HVIDTVQSGCSIARCALGETLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtactgctgggaaaccaaactacaagttttttgagactaaaaaggctacaatc
gttctcgcgccattcagtggtggtcagggaaagtctggtgttgaagatgggccaaagtat
ttgatgaaacagggtctacagcacggactcgagtctgtggggtggcaagtggacgtgaaa
aagcctttggaagggcgtgactttgaacaacggaaaattagctcgcccgaggtggatggc
aaggtcaagaatccgaccattgtgggcgaagccacgcagttgatctacggggcggtgaag
tcagcagcacacgaaggccggctccccgtaacccttggtggcgatcactccatcgccatt
gggacggtttccggtgttcttgataagtatccagatgcaggacttttgtggattgatgcc
catgctgacatcaacactctcgcgtcgactgattcaggaaacctacacggctgtccggtt
tcctttttgatgaatatggaaagggactcatggccagaatccctaaagtgggtcccaggt
accttaaagcccaacaagattgcgtacattgggctcagagatgttgatcccgaggagaag
atcatattgaagaacctcggaatagctgccttctccatgtaccatgttgatcgctacgga
atcaacgccgtcattgaaatggccttgaaggcagtcagcccggatggcaagggtcccatt
atggttagctacgacgtggacgctatcgacccaatgtacgtgcctgctactggaacccct
gtcagaggcggcctcaccttgagagaaggcctatttatcgtcgaaagaattgccgaaacc
ggcaaccttgtcgcgctcgacgttgtagaatgcaacccaggattggcctcgcacgactta
catgtgattgacaccgtccaatctggctgctccattgcaaggtgcgctcttggcgaaacc
ttactatga

DBGET integrated database retrieval system