KEGG   Eremothecium cymbalariae: Ecym_7096Help
Entry
Ecym_7096         CDS       T02237                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
erc00220  Arginine biosynthesis
erc00330  Arginine and proline metabolism
erc01100  Metabolic pathways
erc01110  Biosynthesis of secondary metabolites
erc01130  Biosynthesis of antibiotics
erc01230  Biosynthesis of amino acids
Module
erc_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:erc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Ecym_7096
   00330 Arginine and proline metabolism
    Ecym_7096
Enzymes [BR:erc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Ecym_7096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 11469356
NCBI-ProteinID: XP_003647765
UniProt: G8JVT3
Position
7:complement(186879..187847)
Genome map
AA seq 322 aa AA seqDB search
MTGTAGKPNYKFFETKKATIVLAPFSGGQGKSGVEDGPKYLMKQGLQHGLESVGWQVDVK
KPLEGRDFEQRKISSPEVDGKVKNPTIVGEATQLIYGAVKSAAHEGRLPVTLGGDHSIAI
GTVSGVLDKYPDAGLLWIDAHADINTLASTDSGNLHGCPVSFLMNMERDSWPESLKWVPG
TLKPNKIAYIGLRDVDPEEKIILKNLGIAAFSMYHVDRYGINAVIEMALKAVSPDGKGPI
MVSYDVDAIDPMYVPATGTPVRGGLTLREGLFIVERIAETGNLVALDVVECNPGLASHDL
HVIDTVQSGCSIARCALGETLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtactgctgggaaaccaaactacaagttttttgagactaaaaaggctacaatc
gttctcgcgccattcagtggtggtcagggaaagtctggtgttgaagatgggccaaagtat
ttgatgaaacagggtctacagcacggactcgagtctgtggggtggcaagtggacgtgaaa
aagcctttggaagggcgtgactttgaacaacggaaaattagctcgcccgaggtggatggc
aaggtcaagaatccgaccattgtgggcgaagccacgcagttgatctacggggcggtgaag
tcagcagcacacgaaggccggctccccgtaacccttggtggcgatcactccatcgccatt
gggacggtttccggtgttcttgataagtatccagatgcaggacttttgtggattgatgcc
catgctgacatcaacactctcgcgtcgactgattcaggaaacctacacggctgtccggtt
tcctttttgatgaatatggaaagggactcatggccagaatccctaaagtgggtcccaggt
accttaaagcccaacaagattgcgtacattgggctcagagatgttgatcccgaggagaag
atcatattgaagaacctcggaatagctgccttctccatgtaccatgttgatcgctacgga
atcaacgccgtcattgaaatggccttgaaggcagtcagcccggatggcaagggtcccatt
atggttagctacgacgtggacgctatcgacccaatgtacgtgcctgctactggaacccct
gtcagaggcggcctcaccttgagagaaggcctatttatcgtcgaaagaattgccgaaacc
ggcaaccttgtcgcgctcgacgttgtagaatgcaacccaggattggcctcgcacgactta
catgtgattgacaccgtccaatctggctgctccattgcaaggtgcgctcttggcgaaacc
ttactatga

DBGET integrated database retrieval system