KEGG   Eremothecium cymbalariae: Ecym_7096Help
Entry
Ecym_7096         CDS       T02237                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
erc  Eremothecium cymbalariae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:erc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:erc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(186879..187847)
Genome map
AA seq 322 aa AA seqDB search
MTGTAGKPNYKFFETKKATIVLAPFSGGQGKSGVEDGPKYLMKQGLQHGLESVGWQVDVK
KPLEGRDFEQRKISSPEVDGKVKNPTIVGEATQLIYGAVKSAAHEGRLPVTLGGDHSIAI
GTVSGVLDKYPDAGLLWIDAHADINTLASTDSGNLHGCPVSFLMNMERDSWPESLKWVPG
TLKPNKIAYIGLRDVDPEEKIILKNLGIAAFSMYHVDRYGINAVIEMALKAVSPDGKGPI
MVSYDVDAIDPMYVPATGTPVRGGLTLREGLFIVERIAETGNLVALDVVECNPGLASHDL
HVIDTVQSGCSIARCALGETLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtactgctgggaaaccaaactacaagttttttgagactaaaaaggctacaatc
gttctcgcgccattcagtggtggtcagggaaagtctggtgttgaagatgggccaaagtat
ttgatgaaacagggtctacagcacggactcgagtctgtggggtggcaagtggacgtgaaa
aagcctttggaagggcgtgactttgaacaacggaaaattagctcgcccgaggtggatggc
aaggtcaagaatccgaccattgtgggcgaagccacgcagttgatctacggggcggtgaag
tcagcagcacacgaaggccggctccccgtaacccttggtggcgatcactccatcgccatt
gggacggtttccggtgttcttgataagtatccagatgcaggacttttgtggattgatgcc
catgctgacatcaacactctcgcgtcgactgattcaggaaacctacacggctgtccggtt
tcctttttgatgaatatggaaagggactcatggccagaatccctaaagtgggtcccaggt
accttaaagcccaacaagattgcgtacattgggctcagagatgttgatcccgaggagaag
atcatattgaagaacctcggaatagctgccttctccatgtaccatgttgatcgctacgga
atcaacgccgtcattgaaatggccttgaaggcagtcagcccggatggcaagggtcccatt
atggttagctacgacgtggacgctatcgacccaatgtacgtgcctgctactggaacccct
gtcagaggcggcctcaccttgagagaaggcctatttatcgtcgaaagaattgccgaaacc
ggcaaccttgtcgcgctcgacgttgtagaatgcaacccaggattggcctcgcacgactta
catgtgattgacaccgtccaatctggctgctccattgcaaggtgcgctcttggcgaaacc
ttactatga

DBGET integrated database retrieval system